KEGG   Acyrthosiphon pisum (pea aphid): 100160933Help
Entry
100160933         CDS       T01076                                 

Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial-like
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:api00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 155 aa AA seqDB search
MPSPMKKVRKCTEENVLAFSKLTEHGFQPTKGSEHAAGYDLRSAYSYVVKAHGKELIKTD
IQIKVPQGTYGRVAPRSGLAWKNFIDVGAGVIDSDYRGNVGVILYNHSDEDFIVNKGDRV
AQLICEMIVYPEVVEFKTLDETDRGEGGFGSTGTN
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcccaatgaagaaagtacgcaaatgcaccgaagaaaacgttttggctttctcc
aaactcaccgaacacggtttccagcccaccaagggtagcgaacacgcggccggttacgac
ctcaggagtgcctattcatatgttgtgaaagcccacggaaaagagctgatcaaaaccgac
atccagattaaagttccccaaggtacctatggtcgtgtcgctccacgttctggtcttgct
tggaaaaatttcatcgatgttggtgctggtgtgattgacagtgattatagaggaaacgta
ggtgtcatactatacaaccattctgatgaagacttcatagtaaataagggtgatagagtt
gcccaacttatctgcgagatgatagtttatccagaagtagttgagtttaagacattggat
gagactgatcgaggtgaagggggttttggatctacgggcactaattaa

DBGET integrated database retrieval system