KEGG   Acyrthosiphon pisum (pea aphid): 100161027Help
Entry
100161027         CDS       T01076                                 

Definition
cGMP-dependent protein kinase 1-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100161027
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100161027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 719 aa AA seqDB search
MEDIVHAIAIFENFELQEGAQNIRRHFMKRLDTFTLPDKDFIRNYRLSKRLVHRLINMLR
PYVTEPIRSSTLDIPAKNILENAVSNQFLVPSPQSPQHRLDKKKGVSGECSTATETPIPF
PKQSKPIKTKHLIKQALCKNQFLKNLNTNQISEIVDVMYTKDFEAGSYVIRKGDPGCCLY
VADEGKLDVIQSGRVVDSIGPGDVFGEMAILYNCPRTASVRAVQDVKVWTLERVAYQQIM
KTSAMRRFDERVGFLKSVPLMKDLNEEFLSKIADVLKEEFYPEGHYIIKQGTLGDKFYIL
SEGRVKVTKTNKGEDEEEEFGILEQGEFFGEVALLKKDKRTANVVAMHPGAECLTLDREP
FVHFIGDLEELKNKKYTELPRKPSVQSPVEIKTKTFYPELFRVELTDFETVATIGVGGFG
RVDLVCLKLDRNRSYAMKKLKKQHIVDMQQQEHVYNEKTILESCTSPFIGKLYQTYKDSR
YVYMLMEACLGGEVWTLLRDRRCFDDNAACFVIACVVEALDYLHGVDVVYRDLKPENLLL
DRQGFVKLVDFGFAKRLQPRGKKTWTFCGTPEYVAPEVVLNKGHDRAVDFWALGILVYEL
LAGIPPFSGKDPMDIYNAILKGIGAVNFPRQMNKMTQGLVKQLCRSDPTERIGYQKGGIQ
DIRRHEWFKGFDWTGLRNKSIIPPIVPHINNPLDSSNFDIYPEDGDVPPDESSGWDSEF
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggaggatattgtacacgctattgccatttttgaaaattttgaattgcaagaaggtgca
caaaatattagaaggcattttatgaaaaggttagatacttttacattacccgacaaggat
ttcattagaaattataggttgtcaaaaagattagtacatcggctaatcaacatgttaagg
ccttatgtgacagaaccaattcgttcttcaacacttgatatcccagcaaaaaacattctc
gagaacgcggtatcaaatcaatttctcgtgccatcgccgcaatcgccgcaacaccgactg
gacaaaaagaaaggggtgtcgggagaatgttcgactgcgacggaaactccgataccgttt
cccaaacagtccaaacccatcaagacaaagcatctaatcaaacaggcgctgtgcaagaat
cagtttctgaaaaacctgaacaccaaccagatttctgagattgtagacgtcatgtacacg
aaagacttcgaagctgggtcgtacgtcatcaggaaaggcgatccgggatgttgtttgtat
gtggccgacgaaggaaagctcgacgtgatccagagcgggcgggttgtcgattccatcgga
cctggcgatgtgttcggcgagatggccatactctataactgtccgcggactgcatcggtg
agagccgtccaagatgtcaaggtgtggactttggagagggtggcctatcagcaaatcatg
aagacttctgctatgcggcggtttgacgaacgagtgggatttttgaaaagcgtaccgttg
atgaaggatctcaacgaagagtttttatcgaaaatcgctgacgtcttgaaagaggaattt
tatccggaaggacactacatcataaaacagggcacattgggtgacaagttctacatactg
agcgaagggcgagtgaaagtcacgaagaccaataaaggcgaagatgaagaagaagaattc
ggcattttggaacaaggagagtttttcggggaagtggcgctgttaaaaaaagacaagagg
actgccaacgtcgtggcgatgcatccgggagcagaatgtctcacgttggacagagagcct
tttgtgcatttcatcggcgatctggaggaactaaaaaacaaaaagtacacggaacttccg
cgaaagccctcggtccagtcaccggtagaaatcaagacgaaaacattttaccctgaactg
ttccgcgtggagttgaccgatttcgagacggtcgccacaatcggcgtgggcggcttcggt
cgagtcgatttggtgtgtctgaaactggacagaaaccgatcgtacgctatgaagaaactg
aaaaaacagcacatagtggacatgcagcaacaggagcacgtgtacaatgagaaaaccatt
ttggaatcgtgtacgagcccctttatcggcaaactttaccagacatacaaggacagcaga
tacgtatacatgcttatggaggcttgtctgggcggcgaggtgtggacgctcctccgggat
cggaggtgtttcgacgacaatgccgcgtgtttcgtgatcgcgtgcgttgtggaggcactg
gactacttacacggagtcgacgtcgtctacagggacctgaagccggaaaacctgttgctc
gaccggcagggtttcgtgaaactggtggacttcggctttgcaaaaaggctacaaccgcga
ggcaagaagacatggacgttctgcggcacgcccgagtacgtggccccggaagttgtgctg
aacaagggccacgaccgggctgtagatttttgggctctgggaatactcgtgtacgagctg
ctggctggaatacctccatttagtggaaaagatccaatggacatctacaacgcgatattg
aaaggcatcggtgcggtcaacttcccaagacaaatgaacaaaatgactcaaggtctcgtg
aaacagttatgccgaagtgatcctacggaaaggataggctatcaaaagggtggcatacaa
gatatcagacgacatgaatggttcaaaggtttcgactggactggtttgagaaacaagagt
ataattccacccatcgtaccccatatcaacaatccactagattcgtcaaatttcgatatt
tatcccgaagacggagacgtgccgcccgacgaatcatccggctgggactcggagttttga

DBGET integrated database retrieval system