KEGG   Acyrthosiphon pisum (pea aphid): 100161114Help
Entry
100161114         CDS       T01076                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100161114
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100161114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 424 aa AA seqDB search
MSNNDSNGSSPSGAARPSHPQLDMRQEAAITEKRRQLKLAIQGTSGASFGFNSPIPSLQS
LKFEEDNKLLSNGSTTKQPNSTRVRLSNTETLSEKSRERLKMCQTIQSTGKLQLSENKVY
DFTSDDLQDLGEIGRGGFGTVNKMLHRSSDTVMAVKRIRSTVDENEQKQLLMDLDVVMKS
NECPYIVQFYGALFKEGDCWICMELMDTSLDKFYKYVYEKLNQRIPENILGKITVATVKA
LNYLKEKLKIIHRDVKPSNILLDSRGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERI
DPVRGRGGYDVRSDVWSLGITLVEVATGRFPYPRWSSVFEQLCQVVQGDPPRLQASNNFS
PNFVNFVNTCLIKEENQRPKYNKLLEHIFIKRSDADSVDVASYISEIMAAMENDGAFMYT
MNDP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaatgacagtaacggaagttcaccgtctggagctgcaagaccttctcatcct
cagttagacatgcgtcaagaagctgcgataacagagaaaagaagacagttaaaattagct
attcaaggaacatccggtgcttcatttggattcaattctccaataccaagcttacagtca
ttaaaatttgaagaagataataaattactaagcaatggttcaacaacaaaacaaccaaat
tcaactagagtacggttatctaatactgaaacactaagtgaaaaatcacgagaaagacta
aaaatgtgtcaaacaatacaatccactggaaaactacaactttctgaaaacaaggtgtat
gattttacatcagatgatttacaagatttaggagagattggtcgaggtggctttggaact
gtgaacaaaatgttacatcgtagtagtgatacagtaatggctgttaagaggataagatcc
actgttgatgaaaatgaacaaaaacaattactaatggacttggatgttgtaatgaaatct
aatgaatgcccttatattgtacaattttatggagctcttttcaaagaaggggattgttgg
atttgtatggaacttatggacacatcattggataagttctataaatatgtctatgaaaaa
ttaaatcaacgaattccagaaaatatattgggaaaaataactgttgcgactgtaaaagca
ttgaattaccttaaagaaaaattgaaaattattcaccgtgatgttaagcccagcaacatt
ctattggattctcgaggaaatataaaactctgtgactttggtatctcagggcagttagtg
gattctatagcaaaaactagagatgctggctgccgcccttatatggctccggaaagaatt
gatccagttcgtggtcgaggaggttatgatgtccgttcagatgtttggtccttaggaatc
accctagtagaagttgctactgggcggtttccatatccaagatggagttctgtttttgaa
caattgtgtcaggttgttcaaggagatcctccacgattgcaggcttctaacaacttttcc
cctaattttgtgaatttcgtaaatacttgtttgataaaagaagaaaatcaaaggcctaaa
tacaacaaattactagaacacatattcataaaacgaagtgatgctgatagcgtagatgta
gcttcttatattagtgaaataatggctgcaatggaaaatgatggtgcattcatgtacaca
atgaatgacccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system