KEGG   Acyrthosiphon pisum (pea aphid): 100161198Help
Entry
100161198         CDS       T01076                                 

Definition
(RefSeq) uncharacterized LOC100161198
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00480  Glutathione metabolism
api00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100161198
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100161198
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100161198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 100161198
NCBI-ProteinID: NP_001155475
APHIDBASE: ACYPI002439
UniProt: C4WSF9
Position
Un
AA seq 233 aa AA seqDB search
MKVQEYVLPIFAAISFWAVPIAARGSQGFPYESLDWPTSADISGSSPTGCDKSSSTGYDK
SSEEDNCDGTSCGNIYKYTAKKPNGQNVCLKQYVGKVLIVVNYASACGFTYDNVCTLSEF
AQKYRKCGLEILVFPSNDFLQNIGGNIAAEELANNHPEFEVFSEICVNGRAQHPVYRFLK
YKLPGPFNTKTIKWNFTKFVVDRNGCPVQRYEATDSFKDIEELVQELLKDQCC
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcaagaatatgttcttccaatttttgccgctatttcattttgggcggtgcca
attgctgcaaggggttcccaagggtttccctatgagtctctcgactggccgacgtcggcc
gacatttctggatcgtcacccacaggatgcgacaaatcgtcatccaccggatacgacaaa
tcgtcggaggaggataactgcgatggaacctcgtgcggcaacatttacaaatataccgca
aaaaaacctaacggacagaacgtttgtttgaaacaatacgtcggaaaagtgttgatcgtt
gtgaattacgcgtcagcgtgcggtttcacatacgacaacgtatgcactctgtcggaattt
gcccaaaagtacaggaaatgtggcttagagatactggtattccccagcaacgacttctta
cagaacatcggtgggaatatcgcagccgaagagctcgcaaataatcatcctgaatttgaa
gtattttcggaaatttgtgtaaatggcagagcacaacatccggtgtacagatttctcaag
tataaattaccgggtcctttcaacacaaaaactattaaatggaattttaccaaatttgta
gtagacaggaatggatgtcccgttcaacgatatgaggcgacagacagtttcaaggacata
gaagaattagtacaagaactgttgaaggaccaatgctgctaa

DBGET integrated database retrieval system