KEGG   Acyrthosiphon pisum (pea aphid): 100161224Help
Entry
100161224         CDS       T01076                                 

Definition
UDP-glucuronosyltransferase 2B7-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:api00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:api00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:api00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:api00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:api00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:api00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:api00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:api00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 541 aa AA seqDB search
MRTTKMDYRLQLVTLLLALGCCRGLPNNTRPYNILVFLPTETKSHFMGFQPLLETLVTRG
HNVTLVSPFALGSGGTALTYYTHVKVEITENVAGPVNFLDRNSLMNRLPLYMYTLWLGPM
ITKTAVDKKSVRDFVLGDRSAFDVVVVENFFHECFVTLGHKYGVPVVQLLPFAANPRVSQ
WHGNPYGPAYIADFASDFVAPMTFAQRAQNAVATLFNTWVNRLLYMPMQRAIMDEHFAYA
GHEGRPDLETMLRNVSLTLVNSHPMIGPAAPYVPSYVQVAGMHMKPAGPLPTDLKTILDS
AEHGVIYFSLGSVVKSSKMPQETVSLLLSELAKLKQTVLWKWEDDQLPNLPKNVMVKKWF
PQNDILGHPNCRLFITHGGILSLIEAVYHGVPMLSIPVFGDQAHNSIEAQSRGFALYVPF
FELTAENFGSKLQQLLRDPGFGEAAAKASSIIRDNPTSIMDKAIFWIEFVVRHGGAPHLR
TVANQLYWFQYYMLDVIAAAMALLAVVSYLNFKCLAYLLKKIFGGSKRPASKVSKIKKKR
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaacaaaaatggattatcgtttacagctggtcacgttattgttggccctgggc
tgttgccgtggattgccgaataacacacgtccgtacaacattctggtgtttctaccaact
gagaccaaaagccatttcatggggttccaacccttgctggagacgttagtgaccagagga
cacaatgtgacattagtctcaccattcgcgttgggttccggcgggacggcgttgacgtac
tacactcacgtcaaagtggaaatcaccgaaaacgtggcagggcctgtgaacttcctcgac
aggaactcgctgatgaacagacttccgctgtacatgtacacgttgtggctgggcccgatg
attactaagactgcggtggacaagaagtcggtaagggacttcgtgctcggcgaccggtct
gcgtttgacgtggtggtggtcgagaacttcttccacgagtgtttcgtgacgctcggccac
aagtacggagtgccggtggtgcagctgcttccgttcgccgccaaccctagagtgtcgcag
tggcacggcaacccgtacgggcccgcttacatagccgacttcgcgtccgatttcgtggca
ccgatgacattcgcgcagcgcgcccagaacgccgtggccaccttgttcaacacgtgggtt
aaccgactgctgtatatgcccatgcagcgggccatcatggacgagcactttgcgtacgca
ggccacgagggccggcccgacctcgagacgatgctccggaacgtgtctcttacgttggtc
aacagccacccaatgatcgggccggccgcgccttacgtgccaagctacgtgcaggtggcc
ggtatgcacatgaaaccagccgggccgctgccaacggatctaaaaaccattttggactca
gctgaacatggagtgatttacttcagtttgggttcggtggttaagtcatctaaaatgcct
caagaaacagtatcgctccttttatcagaactggctaagctgaaacaaacggttttatgg
aaatgggaagatgatcagctgcccaacttgccgaaaaacgtcatggtcaagaaatggttc
ccacaaaatgacatattgggccatccaaactgccgtctattcatcacacacgggggcata
ctcagcctaatcgaggccgtataccacggcgtgccaatgctgtccataccggtattcggt
gaccaggctcacaattccattgaagcccagagtagaggattcgctttgtacgtgcccttc
ttcgaacttacggcggagaatttcggatcaaaactccaacagctcttgcgagaccctggg
ttcggggaggcggccgcgaaggcgtcatcaataatccgggacaacccgacctctatcatg
gataaagcaatattttggattgagttcgtcgtccgacacggtggagcgccgcacctgcgc
acagttgccaaccaattatactggtttcaatactacatgttggacgtgatcgccgccgcc
atggccttgctggctgtggtttcatatctcaatttcaagtgtttggcgtacttgctgaag
aaaatctttggtggctctaagcgccccgcatcaaaagtgtcgaaaatcaaaaagaagaga
caatga

DBGET integrated database retrieval system