KEGG   Acyrthosiphon pisum (pea aphid): 100161239Help
Entry
100161239         CDS       T01076                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100161239
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100161239
Transfer RNA biogenesis [BR:api03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100161239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MAQGPALVCRLLASSVSVAHKAGNIIRDVMQKGDLGIIEKGENDLQTEADRSAQRCIVAS
FKNLYPNVNIVAEEVDKISQNLDVPADWLITDLDPKILDLECPKSLLNVTEDQVTIWVDP
LDGTSEFTKGLIDHVTILIGVCVNDEAVAGVIYQPFWQNRGRALWGLVGSGVGGFELKEP
PQTKKVYVTTRSHYDKAIEKFIDGLKPCEVIRVGGAGNKVLYILEGKAHAYVYPSAGCKR
WDTAAPEAVLRAAGGELTDVHGNKYSYSKENEKDPLNKYGVFATAPSYNHTEFMKLISDI
QSKNVKND
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggaccagctttagtttgtagacttttggcttcatcggtatctgttgctcat
aaagcaggtaacataattcgtgatgttatgcaaaaaggagatttgggaataattgaaaag
ggtgaaaatgatttgcaaactgaagctgatagatctgcacaaaggtgtattgttgcatct
tttaaaaatctatatccaaatgtgaatattgtggcggaagaagtagataaaattagtcaa
aatttggatgttcctgcggattggctaattactgatcttgatcctaaaatattggatttg
gagtgtccaaaatcactacttaatgttacagaagatcaagtaacaatttgggtagacccg
ttagatggaacatcagaatttacaaaaggtttaatagatcatgttacaatattaattgga
gtatgtgtcaatgacgaagctgtggctggagtgatttatcaaccgttttggcaaaaccgt
ggtcgagctctttggggtctggttggcagtggtgtaggtgggtttgagttaaaagaacca
cctcaaacaaagaaagtgtatgtaaccactagaagtcactatgataaagcaatagaaaaa
tttattgatggcttaaaaccttgcgaagttatacgagttggtggtgctggaaataaggta
ctttatatattagaaggaaaagcacatgcttatgtttatcctagtgctggttgcaaacga
tgggatacagcagcaccagaggcagtgttaagagcagctggtggtgaattgacagatgta
cacggaaataaatacagctatagcaaggaaaatgaaaaagaccctttaaataaatatgga
gtatttgccacggctccttcttataaccatactgaattcatgaaacttattagtgacatt
cagtcaaaaaatgtaaaaaatgattag

DBGET integrated database retrieval system