KEGG   Acyrthosiphon pisum (pea aphid): 100161326Help
Entry
100161326         CDS       T01076                                 

Definition
serine/threonine-protein kinase minibrain-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100161326
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100161326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 543 aa AA seqDB search
MDGSNGAKQADSWHKHEPFMMVEKQKNKNHGQGSQDSNFGFGGGPLYGRLVAEDQLPMVG
GVAPVHADIHAMQARIPPHFRDPSTAPLRKLSVDLIKTYKFINEVYYAKKKKRAGGGAVG
LSSQPQNNGAPVEGPVANKKERRVYNDGHDDDNHDYIIRSGEKFLDRYEIISLLGKGSFG
QVVKARDEEEDCYVAIKIIKNKKPFLNQAQIEVRLLEMMNRADVDNKYYIVKLKRHFMWR
NHLCLVFELLSYNLYDLIRNTNFKGVSLNLTRKFAAQLCTALLFLSTPDLSIIHCDLKPE
NILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCIL
VEMHTGEPLFSGTNEVDQMNKIIEVLGMPPKHILDQAQKAHKYFDKLPGVDSYTLKKPKD
AKKYRNPGGRRLHDILGVETGGPYARRLGEPGHSVSDYLKFKDLIVRMLDYDPKTRITPY
YALQHNFFKRTSEEGTNTASGIAQAGLHSLGASPPFNSLPSNNPGDTNVQSSGNTFPTHF
YAR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacggcagcaatggagccaaacaagccgacagttggcataagcatgagccattcatg
atggtcgaaaagcagaaaaataaaaatcatgggcaaggatcccaagacagtaactttggt
tttggcggtggtcccttgtatggaagacttgtcgctgaagaccaattaccaatggttggt
ggtgttgctccggtgcatgctgatatccatgcaatgcaagcaagaataccaccccatttc
cgagatccgtcaaccgctccattgagaaagctttcggtggacctaatcaagacatataag
tttattaatgaggtctactatgctaagaaaaaaaaaagagctggtggtggagcagttggg
ttgagtagtcaacctcaaaataatggggctcccgttgaaggacctgtggccaataaaaaa
gaaagaagagtgtataatgatggtcacgacgatgataaccatgattatataattagaagc
ggtgaaaagtttttggatcgctatgaaatcatatccttgctaggcaaagggtcatttgga
caagttgttaaggctcgtgacgaggaagaagattgttatgtagcaattaaaataataaag
aacaaaaaaccattcctaaatcaagctcaaattgaagtaagactattagaaatgatgaat
agagctgatgttgacaacaaatactatattgttaaactcaagcgtcattttatgtggcgt
aatcatttgtgcctggtgtttgagttgttatcttataacttgtatgatttgattaggaac
actaattttaaaggtgtttctttaaatcttacacgtaaatttgctgctcaactgtgcacg
gctctgttgttcctgtccacaccggacctgtccatcatacattgtgatctgaaaccagaa
aacatattgttgtgcaatcctaaaagatcagctattaaaatagttgactttggctcatct
tgccaactcggccaaagaatatatcaatatattcaatctcgtttttaccgttcacctgaa
gttttacttggtataccttatgatttggctatagacatgtggagtttaggatgtatttta
gtagaaatgcatactggagaaccgttgtttagtggaacaaatgaagttgatcagatgaat
aaaatcattgaagttcttggcatgccacccaaacatatacttgaccaggctcaaaaagct
cacaaatattttgataaattgcctggtgtcgattcgtacaccttaaaaaaacctaaagat
gctaaaaagtacaggaatccaggtggtcgacggttacatgatatattaggtgtcgaaaca
ggcggtccatatgctaggcggttaggtgagcccgggcattcagtatctgactaccttaaa
tttaaagatcttatagtacgaatgctagattatgatccaaaaactcgaattacaccatat
tatgctttgcaacataacttcttcaagcggacttctgaagagggtactaatacagctagt
ggtatcgctcaagctggactacacagcttaggtgctagtccaccatttaatagtttacct
agtaataatccaggggacacaaatgtgcaatcatctggaaacactttccctacacatttt
tacgctcgatga

DBGET integrated database retrieval system