KEGG   Acyrthosiphon pisum (pea aphid): 100161327Help
Entry
100161327         CDS       T01076                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:api00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:api04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 442 aa AA seqDB search
MDPSSFIKKVTVKATFDYESRQDDELSFCKHAVITNVVKQDSGWWRGDYGGKRQHWFPSN
HVEELQEAHIEKSDSGSTESMFLGNSQKGSLDLTGALVEIGKLNQLKLEWMIKIQTSNAC
TPFVVGSVSREQAEEWRNLIIETAHNASARETENKKMERQLKIAKEISDLIIYCRSVAFC
LETQRERGFVHNEMSSFPENKAEKLMCHQESVFFFRYHQIQFSRVFPKGQRIDSSNYSPI
AIWNTGCQMAALNYQSPDKSMQLNQAKFRLNGGCGYVLKPDYMLDESDKLSTNWMEETLS
LTVCIIAGRHVGRPGRNGISNPFVIVEVYGAEYDSGLKLNTRTIPDNGFNPVWNETSEFE
IANPAVAFIRFVVNDEDMFGDSNFIGQGTYSIISLRSGYRSVPLKNGYSEDIPLASLLVH
ITIRSNTVSKPNNNFFFKSIQS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggatccgagtagtttcatcaagaaggttactgtgaaagcaacatttgattacgagagc
cgacaagatgatgaattgtcattttgcaagcatgctgtaattacaaatgtagtgaaacag
gacagtggttggtggcgtggtgattatggtggaaaacggcaacattggtttcccagtaat
catgtagaagaattacaagaggcacacatcgaaaaatctgacagcggttcaacagagtct
atgtttttgggaaattcacaaaaagggagtttagacttgactggcgctttagttgagatt
ggcaaattaaatcaactgaaacttgagtggatgatcaaaatacaaacatctaatgcatgc
accccattcgttgtaggttcagtatcacgagaacaagcggaagaatggagaaatcttatt
atcgaaactgcccataatgccagtgcaagagaaacagaaaataaaaaaatggaaagacag
ttgaaaattgccaaagaaatatctgatcttattatttattgtcgatcagtggcattttgt
ctagaaacacaacgagaacgtggatttgtacacaatgaaatgtcttcttttcccgaaaat
aaagcggaaaaacttatgtgtcatcaagaaagcgtattcttctttcgttatcatcaaatt
caatttagtagagtatttccaaaaggtcaacgcattgactcctctaattattcgccaata
gctatatggaatacaggatgtcagatggctgctcttaattaccagtcaccagataaatca
atgcaattaaatcaagccaaatttcgtttaaacggtggttgtggctatgttttaaaacca
gattatatgttagacgaaagtgataaactctcaacaaattggatggaagagacattatca
ctaacagtttgtattattgctggtcgacatgttggtagaccaggtcgtaacggaatttct
aatccatttgttattgttgaggtgtatggagctgaatacgattcaggattaaaattaaat
acacgcacaatacctgataatggatttaatccagtttggaatgaaacttctgaatttgaa
attgcaaatcccgcagttgcatttattagatttgttgtgaatgatgaagatatgtttggt
gattccaatttcataggacaaggaacatattcgataatttcattgaggtcaggttataga
agtgttccattaaaaaatggctattctgaagatattcctttagcgtctctcttagtacat
atcacaattagaagtaatactgttagcaaaccaaacaataactttttttttaaatctatt
caaagttaa

DBGET integrated database retrieval system