KEGG   Acyrthosiphon pisum (pea aphid): 100161593Help
Entry
100161593         CDS       T01076                                 

Gene name
Dhfr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100161593 (Dhfr)
   00670 One carbon pool by folate
    100161593 (Dhfr)
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100161593 (Dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 184 aa AA seqDB search
MNPTDDMVYSVIAAVSKNGGIGYKGNLPWKIKKEMEYFNLMTTRVNLKGVQNAVIMGRCT
WQSIPDKYRPLKGRINVVISKTLNSVPEGVLLYPKLEEALKSLYLNDRIENLWVIGGSGL
YKEAVNDKNCKKLFITKIDQEYLCDTFFPDFDTKKFEETSEANVPKGIQEDNGIKYEFKV
FKRL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaccgatgatatggtttacagtgtcatagctgctgtttcaaagaatggaggt
attggctacaagggtaatctaccatggaaaattaaaaaggaaatggaatacttcaatctg
atgactactcgggtgaatcttaaaggcgttcaaaatgcggttattatgggtcgctgtact
tggcaatcgattccagataaatataggccactaaaaggacgaataaatgtagttatttct
aaaacattgaacagtgtgccagaaggtgttttattgtatccaaaacttgaagaagcctta
aaatcattatatttaaatgatcgtattgagaatctttgggtaattggtggttcaggattg
tacaaggaagctgtaaatgataaaaattgcaaaaaattatttattacaaaaattgatcaa
gaatacttgtgtgatactttctttcccgattttgatactaaaaaatttgaagaaacaagc
gaagcaaatgtacctaaaggaattcaagaagataatggtattaaatatgaatttaaagtt
ttcaagaggttatga

DBGET integrated database retrieval system