KEGG   Acyrthosiphon pisum (pea aphid): 100161603Help
Entry
100161603         CDS       T01076                                 

Gene name
Su(var)3-9
Definition
suppressor of variegation 3-9
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100161603 (Su(var)3-9)
Enzymes [BR:api01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100161603 (Su(var)3-9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MHKGVADNEYEIESILFDDTYGSKTMYLVKWKNYPMDQCTWEPYRNLTNCAQALNDYRSN
KIVATEIYQTTRYKELYDSLNIFADQELLELLHHVIQDGMPSIDEKFVRGTIAYLSTVSP
SSRSLSLTKLIRHNLMIIEVDKKRQKQQDRLNKWQNDMAAVCGFNISVLNNVDFEGPPKR
FYYVDECVAGKGVVIPNDPPVWCHCDVTCGGKKRKKTECHFGDFQMAYNKFKRIIVPQGT
PIYECNRKCTCDATCVNRVVQHGPSKNLKLQIFRTDNNRGWGVKTLLSIKQGTYITKYTG
EVITRSEADQRAVTHGSKSTYLFDLDYNTEKNDSVYSIDATTYGNVSHFINHSCDSNLAI
FAVWIDCLDTNIPTLALFASRDISAGEEITFNYMTSVNNENRRIKCKCLSDNCRGYLC
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaggagtggctgataacgagtatgaaatcgaatccattttattcgatgataca
tatgggagcaaaacaatgtatctcgtaaaatggaaaaactaccccatggaccaatgcaca
tgggaaccatatcgaaatctgacaaattgtgcccaggcattaaatgattacagatcaaat
aaaatagttgcaactgaaatctaccagactacacgttataaagaactgtatgactcgcta
aatatttttgcagatcaggaactacttgaattattgcaccatgtaattcaggatggaatg
ccttctatagatgaaaaatttgttaggggtacaattgcgtatttatcaactgtatcaccc
agtagtaggagtttgtctttaactaaactcatcagacataatttaatgataattgaagtt
gacaaaaaaagacaaaaacaacaagatagattaaataaatggcaaaatgatatggcagca
gtatgtggtttcaatataagtgtactaaacaatgttgacttcgaaggtccgccaaaacgt
ttttattatgtggatgaatgtgtggcaggcaaaggcgttgttattccgaatgaccctcca
gtttggtgtcactgtgacgttacctgcggaggaaaaaaacgtaagaaaaccgaatgtcat
tttggcgattttcaaatggcgtataataaatttaagcgcatcatagttcctcaaggcact
cctatttatgagtgtaatagaaaatgtacttgtgacgcaacgtgtgtaaatagagtggtt
caacatggtccaagcaaaaatttaaaacttcaaatattccgtactgacaacaatcgcggt
tggggagtcaaaacattgttgagtataaaacagggtacttatattaccaaatataccggt
gaagtaatcaccagatcagaagctgatcaacgggctgtcacacatggatcaaagtcaaca
tacttgtttgatcttgactacaatactgagaaaaatgatagtgtttattctattgatgct
actacatatggtaatgtatcacattttataaatcattcgtgcgattctaatctggccata
tttgctgtatggatcgattgcttggatactaatataccaactctggcattattcgcgtct
agagatattagtgcaggtgaagagattacattcaattatatgacttctgtcaacaatgaa
aatcggagaattaaatgtaaatgtttatctgataattgccgtggttacctgtgttag

DBGET integrated database retrieval system