KEGG   Acyrthosiphon pisum (pea aphid): 100161632Help
Entry
100161632         CDS       T01076                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100161632
Transfer RNA biogenesis [BR:api03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100161632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 547 aa AA seqDB search
MSEVDENISKLSHEERMVSTVAEIIQKLLIAQKENRDVNLNKLKSQISSKYGLKSSPRLV
DIISAVPNDAKKLLYPKLKAKPVRTASGVAIVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRAHYNPYVQTRHRVEQLKQLGHNVDKVEFIVMGGTFMSLP
EDYRDYFIRNLHDALSGHTSSNVREAVKYSERSNVKCIGITIETRPDYCLNRHLTDMLNY
GCTRLEIGVQSVFEDVARDTNRGHTVKAVCETFNLAKDCGFKIVSHMMPDLPNVDLERDL
QQFKEFFENPAFRVDGLKIYPTLVMRGTGLYELWRSGRYRSYSPSELVDLIAHILSLIPP
WTRVYRVQRDIPMPLVTSGVEHGNLRELALARMKDLNLQCRDVRTREVGIQEIHNKIRPF
EIELIRRDYVANNGWETFLSYEDPEQDILIGLLRLRKCTDSFRPELKGRVSIIRELHVYG
SVVPVRSRDPTKFQHQGFGMLLMEEAERISLDEHKSTKIAVISGVGTRNYYKKLGYHLDG
PYMSKQL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtagacgaaaacatatccaaattaagccatgaagaacgaatggtttccaca
gttgctgaaattattcagaaattgttgattgcgcaaaaggaaaacagagatgtaaactta
aataagttaaaatctcaaatatcatcaaaatatggactgaaatcatctccccgactcgtt
gatattatttcagctgttcccaatgatgccaaaaaattattgtatccaaagttgaaagca
aaacctgttagaacagctagtggagttgcaattgttgcagttatgtgtaagccacatcgt
tgtcctcacataaatatgactggaaatatatgtgtatactgtcccggtggtccagattcc
gattttgaatattctacgcagtcatatactggttacgaacctacttcaatgagagctatt
cgagcacattataatccatatgttcaaactcgccatagggttgaacagcttaaacaatta
ggccataatgttgataaggttgagtttatagtaatgggaggtacattcatgagtttaccc
gaagactaccgggattatttcataaggaacttgcatgatgctttatcaggtcataccagc
tctaatgttcgagaagctgtcaaatactctgaaagaagtaatgtaaaatgtattggcatt
acaattgaaactcgaccagattattgtttgaatagacatttgactgacatgttaaactat
ggttgtacacgattagagattggtgttcagtctgtgtttgaagatgttgcacgagacact
aacagaggtcatacagttaaagcagtgtgtgaaacatttaatcttgctaaagattgtggt
tttaaaattgtatcacatatgatgcctgatttacctaatgtagatctagaaagagacctt
caacagtttaaggaattttttgaaaatccagcatttcgagttgatggtttaaaaatttac
cctactcttgtaatgagaggcactggtttatatgagctgtggcgtagtggacgataccgg
agttattcaccatctgaattagtagatttaattgctcacattttaagtcttattcctccg
tggacgcgtgtgtatagagttcaaagagatattccaatgccattagttacatctggagtt
gaacatgggaatttacgagaactggccttagcaagaatgaaagatcttaacttacaatgt
cgtgatgttcgaactagggaagttggaattcaagaaatacataataaaattcggccattt
gaaattgaattgatacgcagagattacgttgcaaataatgggtgggaaacatttttatcg
tacgaagaccctgaacaagacattttaataggtttattaagattgcgcaagtgtacagat
tcgtttagacctgagttaaaaggaagagtttcaatcatacgagaattacatgtgtatggt
agtgtagttcctgttcgatctagagatccaaccaaatttcagcatcaaggatttggtatg
ctattaatggaagaagctgaaagaatatctttagatgaacacaagtctaccaaaatagct
gttatttcaggtgttggtactagaaactattataaaaaacttggataccacttggatgga
ccttatatgtcaaaacaattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system