KEGG   Acyrthosiphon pisum (pea aphid): 100161663Help
Entry
100161663         CDS       T01076                                 

Definition
(RefSeq) tropomyosin-like
  KO
K10373  
tropomyosin 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Cytoskeleton proteins [BR:api04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100161663
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100161663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 283 aa AA seqDB search
MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARALQKKIQTIENELDQT
QEQLMSVSAKLEEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA
DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTNRLKEAEARAE
FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDQTFSELVD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaaaatgcaggcgatgaagctggagaaggacaatgccatggac
agggccttattatgcgaacaacaagctcgtgatgccaatttaagagccgaaaaggctgaa
gaagaggcaagagccttacaaaaaaagattcaaacaattgaaaatgagctcgaccaaact
caggaacagcttatgtcagttagtgccaaacttgaagagaaggacaaggctttgcaaaat
gctgaaagtgaagttgctgcacttaacaggcgtatccaattgctggaagaggaccttgaa
aggtctgaagagcgcttggccacggccactgctaagttggccgaggcatctcaagctgct
gatgagtctgaacgtgcacgtaaggtgttggaaaaccgcagtttggccgatgaagaacgt
atggatgccttggagaatcagctaaaggaagcccgcttcttggctgaagaagctgataag
aaatatgatgaggtagcgcgtaagctggccatggttgaagccgacttggaaagagccgaa
gaacgtgccgaatcaggcgaatcaaagatcgtggaattggaagaagaattacgtgttgtt
ggcaacaacttgaaatctctcgaggtttcggaagaaaaggcaaatcaacgtgaagaagaa
tataagaaccaaattaagactttgaccaaccgtttgaaggaggctgaggcacgcgctgaa
ttcgctgagagatcagtgcagaaattgcagaaggaagtcgacaggctcgaagacgagttg
gtacacgagaaagagaaatacaaatacatttgtgacgatcttgaccaaacgttctctgaa
cttgttgactaa

DBGET integrated database retrieval system