KEGG   Acyrthosiphon pisum (pea aphid): 100161663Help
Entry
100161663         CDS       T01076                                 

Definition
tropomyosin-like
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 283 aa AA seqDB search
MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARALQKKIQTIENELDQT
QEQLMSVSAKLEEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA
DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTNRLKEAEARAE
FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDQTFSELVD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaaaatgcaggcgatgaagctggagaaggacaatgccatggac
agggccttattatgcgaacaacaagctcgtgatgccaatttaagagccgaaaaggctgaa
gaagaggcaagagccttacaaaaaaagattcaaacaattgaaaatgagctcgaccaaact
caggaacagcttatgtcagttagtgccaaacttgaagagaaggacaaggctttgcaaaat
gctgaaagtgaagttgctgcacttaacaggcgtatccaattgctggaagaggaccttgaa
aggtctgaagagcgcttggccacggccactgctaagttggccgaggcatctcaagctgct
gatgagtctgaacgtgcacgtaaggtgttggaaaaccgcagtttggccgatgaagaacgt
atggatgccttggagaatcagctaaaggaagcccgcttcttggctgaagaagctgataag
aaatatgatgaggtagcgcgtaagctggccatggttgaagccgacttggaaagagccgaa
gaacgtgccgaatcaggcgaatcaaagatcgtggaattggaagaagaattacgtgttgtt
ggcaacaacttgaaatctctcgaggtttcggaagaaaaggcaaatcaacgtgaagaagaa
tataagaaccaaattaagactttgaccaaccgtttgaaggaggctgaggcacgcgctgaa
ttcgctgagagatcagtgcagaaattgcagaaggaagtcgacaggctcgaagacgagttg
gtacacgagaaagagaaatacaaatacatttgtgacgatcttgaccaaacgttctctgaa
cttgttgactaa

DBGET integrated database retrieval system