KEGG   Acyrthosiphon pisum (pea aphid): 100161992Help
Entry
100161992         CDS       T01076                                 

Definition
neuroendocrine convertase 1-like
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100161992
Peptidases [BR:api01002]
 Serine Peptidases
  Family S8: subtilisin family
   100161992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 507 aa AA seqDB search
MVNWAKQGFSKKLYKRVPTDVRSRYESYFNDELWKLQWYEQGYRNNYTNGMPLDMNLVPV
YEELKCTGKGIRVAIIDDGIEYTHDDLKDNYDEEISINLNWNKKDPMPRYEDPTNSHGTR
CAGEIAMAANNKKCGVGVAYNAKVGGIVLLDGKTNDEMEARALINANSLVDIYSGSWGPT
DDGLMVDGPGVMAQIAFEIGATKGRNGKGSIYVFASGNGRMLFDNCASDGYVGNIHTVAI
SSVTMEGTAPEYAERCAAVIATAYSGGLDNGVKIVTSDINNTCTLSHTGTSAAAPLAAGV
IALALEANGNLTWRDVQHLLVRNCEVAPLLKNSGWSTNAAGFDFNPQFGFGLLNAYKLVK
EAIGWKTVPEKSICVKNFQIPKKYKHFGRVSKFVSTVITNGCNGYIRYLEHVQLCVTIRY
PKRGMVEIDLQSPKNTTCKMMEPRPLDESNGGFFEWKIKSLQFWGENPSGKWTVIVKDET
SKLFTGLTGSVEKLRLIMHGTKENPYN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtgaattgggccaaacagggattttcgaaaaagttgtataaaagagtgccgacggac
gtccgcagcagatatgagagttattttaacgacgaactttggaaactgcagtggtacgag
caaggttaccggaataattataccaacggaatgccactagatatgaacttagtaccagta
tacgaagagttaaaatgcacaggtaaaggtattcgggtagcgataatcgatgatggaata
gaatatactcacgatgatcttaaggataattatgatgaagaaatcagtatcaatctgaac
tggaataaaaaggatcctatgcctaggtacgaagatcctacaaattctcatggtactaga
tgtgctggagaaattgcaatggctgcaaataataaaaagtgtggtgtaggcgttgcttac
aatgcaaaagtaggaggtatcgtattgctggacggtaaaacaaacgacgaaatggaagct
agagccttaattaacgctaattcattggtggatatatacagtggatcatgggggcctaca
gatgacggactaatggtcgacggtcccggagtaatggctcaaattgcatttgaaatcggt
gcaaccaagggtcgaaacggcaaaggttcaatatacgtattcgcgtcgggcaatggtcgt
atgctgtttgacaattgcgcatcggacggctacgtgggaaacattcacacagtggctatt
agcagtgtcactatggaaggtacagctcccgagtacgccgagagatgtgccgccgtcata
gcaactgcttattccggtggcctggataatggtgtcaaaatcgttacgtcggatatcaat
aatacatgcacgctttcacatactggcacatcagccgcagctccgctagcagcaggagtt
atagctttagctctcgaagccaatggcaatctgacgtggagagacgtgcaacatttattg
gtaaggaactgtgaagttgcacctctgttgaaaaactccggttggtccactaacgcagca
ggattcgactttaatccccagttcggttttggattattaaacgcctataagttagtgaaa
gaagctattggctggaaaaccgtaccagagaaaagtatttgtgttaaaaatttccaaatc
cctaaaaaatataaacattttggccgagtctcaaaatttgtgtccacggtaataacgaat
ggctgtaacggatacatcagatatttagagcacgtacaactatgtgtgaccattcggtat
ccaaaacgcggtatggtcgaaatagatctacaatcaccaaaaaacaccacgtgcaaaatg
atggagccacgacccttagacgagtcaaacgggggattttttgaatggaaaataaaatca
ttgcaattttggggcgaaaatccatctgggaagtggacggttattgtcaaagatgaaact
tctaaattattcaccgggttaactggctcagtggaaaaacttagattaataatgcatgga
actaaagaaaatccttacaattaa

DBGET integrated database retrieval system