KEGG   Acyrthosiphon pisum (pea aphid): 100162127Help
Entry
100162127         CDS       T01076                                 

Definition
(RefSeq) histone acetyltransferase p300-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04068  FoxO signaling pathway
api04310  Wnt signaling pathway
api04330  Notch signaling pathway
api04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100162127
   04330 Notch signaling pathway
    100162127
   04350 TGF-beta signaling pathway
    100162127
   04068 FoxO signaling pathway
    100162127
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100162127
Transcription factors [BR:api03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100162127
Chromosome and associated proteins [BR:api03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100162127
Mitochondrial biogenesis [BR:api03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100162127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX zf-TAZ DUF902 Bromodomain ZZ
Motif
Other DBs
NCBI-GeneID: 100162127
NCBI-ProteinID: XP_003242232
APHIDBASE: ACYPI003301
UniProt: J9JSK5
Position
Un
AA seq 2051 aa AA seqDB search
MSDLLVDSPPNKRPKLEDPFQGSSDSSGVYSSNEMFDLENDLPDELISTTSWNQQPDIKP
NLGPQLPLQNGMIVQQNNPQQLQQPNIQQRLVVSQHQLAHHFMGTKHLVSATGMSMNKPI
NPNMPSPNVLVSKTGEPMVVNMGNAGINSNQLQNSVSGINVANVNIMMGNNLVSNSMHNP
HHGIPQQQQNGPMMLRNIAMHHPQQIRNQTPHQLHSLPINSHRLQAPMGAMSPVNNFNAY
NQNNQQINVVQQQPIGIVRQPVPRFNANTNGMLVDTPVPPQSQANVRLGPQQVNMVNQNV
VVPPQGVPSDRSQANPEKRKMITQQLVLLLHAHQCQRRDNQANGEVRQCRLQHCNTMKGV
LAHMTNCLAGRNCNVAHCSSSRQIISHWKQCTRPDCPICQPLKASNNRNALANNTTQNTT
GMNDMNCYSTVNNQVNQVQGVPNNVGIRTALQSQMPHPPNNNVLTPNQNTRVLVPHSQPQ
VTTTMSADPSTSSVNEMLQSASNTTVPVPSSIQQSATNIPNSFIMTTSTDTMTTQMNNQA
QPSQSIPGNHIESKEWHESITPELRNHLVHKLVQAIFPTYDPKAMLDKRMNNLVAYARKV
EGDMYNVANSRSEYYHRLAQTFYKIQKELEEKMQKRKEQQQMQQQQLGTQQPTNNINAQC
FPTASTQGLPTQQQPSQPQQQQPLHHTSIQPNQQNLPQQQVVTTSGLMKTQMSDRVHFPI
TSPVPGPSPNPNLPPTTFGLTQPPVPSPINTSQFPSNSPMMSNISQASFAQPQFPNQSMN
QMPQQIHLQQQVQQQQQVQQQQQQVQQQVQQQQHLNNQMLQPNRLNQMNMEKMVNGPSLI
ANNTVPSTTSVPSMMPNSMGKGYPRSEPSSISHSSQMNAIASALAQDDSPKDVKGEVKDE
YDDSNDGKGAYGKGKMNSETPSASVKSEIKQERDDNGSSSKKMEVKIKDEPMSPKPNITT
DIKPFEPTTSDSKTAIKKCVFRPDELRQALMPTLEKLYKQEPESDPFKQPVDPQALNIPD
YFIIIKKPMDLSTIREKLNTGQFSDPWSYVDDVWLMFENAWHYNKKSTKVYKSCTKLSEV
FEQEIYPVMRSLGYCCGRKYTFNPQVLCCFGKQLCTIPRDAKYFSFENRYIYCVKCFNDI
PGDAVTLGEDPTQAQQVIKKEQFMEMKNDHLELEPFILCTHCGRKLHQICVLHNENINPL
GYVCDNCLKKRGEKRKDHKFNAKKLAITKLGTYIETRVNNFLKKKEAGAGEVAIRVVSSS
DKIVEVKPGMRSRFVDNGEMIGEFPYRAKALYAFEEIDGTDVCFFGMHVQEYGSEAPSPN
TRRVYIAYLDSVNFFRPKQYRTYVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFH
CHPPEQKIPKPKRLQEWYKKMLDKGIIERIILDYKDILKQAIEDKLSSAAELPYFEGDFW
PNALEDSIKELDQEEEQKRKLAEAEESVEMCVSDEVEIGPDGKKKGMQKSKKSNKSKSSQ
RKSSSKKTMLPQTSSDLSAKIFDNMDKHKEVFFVIRLHSVQSAAALGAIQDPDPLISCDL
MDGRDAFLTMAREKHYEFSSLRRAKFSSMAMLYELHNQGQDKFVYTCNSCKSHVETRYHC
TVCDDFDLCITCYDKEKHPHTMEKLGLDLDDGSSPGDQKQADPQEARKLSIRRCILSLVH
ACQCRDANCRLASCQRMKRVVQHVKLCKVKSNGNCPICKQYIALCFHHAKYCTEAKCPVL
FCPNMKHKIKQQQLQQRLQQAQLLRRRMAIMNTGTLGTENTTPVVATQHMSNQTKMIPHK
GPVMVPGKQTPPANVLQVVKQVQEEAARQHDNVGYGKGGPQQQMQRPHMQIAPPVPQQVN
QWVTEPNYNQMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVQQQQQRQMNI
QPQQQMILNNPQNPMLQQQQVMTSRPQGYQQNPNQQVPNQSLQQLLNALRTNTDSPPEQQ
QRLREILRSNPQLLAQFIRNQRQRQMFQQQQQQQGGAIAPPMYPQQMQGQPQPGPQGPNQ
PQSNMQNRMHL
NT seq 6156 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacctattggtggatagccctccgaacaagaggccaaagttggaagatccattt
caagggtcttctgactcatctggtgtctattctagcaatgagatgtttgatctcgagaat
gatctccctgatgagcttattagcactacgtcttggaaccagcaacctgatatcaagcca
aatcttggtcctcaattaccattgcaaaatggtatgattgttcagcaaaataatcctcaa
caacttcaacaacctaatattcaacaacgattagtagtcagtcaacatcagttagctcac
cattttatgggtactaaacatctcgtgtcagcgactggaatgtctatgaataaaccaatt
aatccaaacatgccatcaccaaatgttttagttagtaaaactggagaaccgatggttgta
aatatgggaaatgcaggcattaattccaatcaattacaaaatagtgttagtggaataaat
gtagcaaatgtaaatattatgatgggaaacaatttggttagtaattcaatgcacaatcct
catcatggcataccccagcaacaacaaaacggacctatgatgttacggaacatagccatg
catcatccacaacaaattcgcaaccagactcctcatcaacttcatagtttgccaattaat
tctcataggttacaagctccaatgggtgcaatgagtccagtgaataatttcaatgcatac
aaccaaaataatcaacaaattaatgttgtccaacaacaaccaattggtattgtacgacaa
ccagtaccgagatttaatgccaacactaatggaatgttagtagatactccggttcctcct
cagtctcaagcaaatgtacgtcttggaccacagcaagttaatatggtcaatcaaaatgta
gttgtaccacctcaaggagttccctctgaccgtagtcaagcaaatccagaaaaacgaaaa
atgataacccaacagcttgtgctattattacatgcacatcaatgtcagagacgagataat
caagctaatggcgaagtgagacaatgtcgtttgcaacattgtaatacaatgaaaggagtc
ttagctcatatgaccaattgcttagctggtcgaaattgtaatgtagctcactgttcgtca
tctagacaaataatatcacattggaaacaatgtactagaccagattgtcctatttgccaa
ccattaaaagcatcaaataatcgcaatgctttagcaaataacactactcaaaatactact
ggaatgaacgatatgaattgttatagcactgtaaataatcaagtgaaccaagtacaggga
gtccctaacaatgttggtatacgaacggctttgcaatctcaaatgccacatcctcctaat
aacaatgtgctgacacctaatcaaaatacacgcgtattagtcccacattcacaaccccag
gtaacaactacaatgagtgcagatcccagtacaagttctgtaaatgaaatgctgcagtct
gcttcgaacacaactgttccagttccatctagcattcaacaatctgcgacaaatattcct
aattctttcataatgacaactagtactgatacaatgactactcagatgaacaatcaagca
caaccgagtcaatcaataccaggaaatcacattgaaagtaaggaatggcatgagtctatt
acacctgaactaagaaatcatttagtgcataaattagttcaagcaattttcccaacatat
gatcctaaagcaatgcttgataaacgtatgaataatttagtggcttatgctagaaaagta
gaaggtgatatgtacaatgttgcgaactctaggtcagaatattatcataggttagcccaa
acattttataaaatacaaaaagagttggaagaaaaaatgcaaaagcgaaaagaacaacaa
caaatgcaacagcagcaattgggaactcagcaaccgactaataatatcaatgcacaatgc
ttcccaactgcgtctacacaaggattgcctactcagcagcaaccatcacaaccacagcag
caacaacctttacatcatacttcaattcaacccaatcagcaaaatttgccacaacaacaa
gtagtaacaacatctggtctaatgaaaacacaaatgtcagacagggtacattttccaatc
acttcacctgtacctggaccaagtccaaatccaaatttacccccaactacttttggtttg
acccagccacctgtcccaagtccaatcaacactagtcagttcccatctaactcacctatg
atgtcaaacatatctcaagcttcgttcgctcaacctcaatttccaaatcaatcaatgaat
caaatgccacaacaaatacatttacaacaacaagttcaacagcaacaacaagtgcaacag
caacaacaacaagtacaacagcaagttcaacaacaacaacacttgaacaatcaaatgtta
caaccaaatagacttaatcaaatgaatatggaaaaaatggttaatggaccaagtttgata
gcgaataatactgtgccatcaactacaagtgtaccatcaatgatgcccaatagtatgggt
aaaggctatcctagatcagaaccatcatcaattagtcattcgagtcagatgaatgctatt
gcttctgctttagcacaagatgactctcccaaggatgttaaaggggaagtaaaagatgag
tatgatgatagtaatgatggaaaaggtgcttatggaaaaggtaaaatgaattctgaaaca
ccgtcggcatctgtgaaatctgaaattaaacaagaacgcgacgataatggttcaagttca
aagaaaatggaagttaaaattaaagatgaacctatgagtcctaaaccaaacatcactaca
gatattaaaccatttgagccaactacatcggacagtaaaacagccataaagaaatgtgta
tttaggcctgatgaacttagacaagccttaatgcctactcttgaaaaattatacaaacaa
gaacctgaatcagatccttttaaacagcctgttgatcctcaagcacttaatatacccgac
tatttcataatcataaaaaagccaatggatttatcaacaattcgagaaaaattgaatact
ggtcaattttctgacccttggagttatgttgatgatgtttggttaatgtttgaaaatgct
tggcattacaataagaagtctacaaaagtatataaatcatgtacaaaactttcagaagtt
tttgaacaagaaatttatcctgttatgagaagtcttggttattgctgtggtcgtaagtat
acattcaatccgcaagtactttgttgttttggaaaacaattgtgtactattccaagggat
gctaaatacttcagttttgaaaatagatatatttattgtgttaaatgctttaatgatata
cctggtgatgctgtaacattgggcgaagaccctacacaagcccaacaagtaattaaaaaa
gaacaatttatggaaatgaaaaatgatcatctagaattggaaccattcatattatgtact
cattgtggaagaaaactccatcaaatatgtgtgctgcacaacgagaatattaatccacta
ggatatgtttgtgataactgtttgaagaagcgcggtgaaaaacgaaaagatcataaattc
aatgctaaaaaattggctataacaaaattaggtacgtacattgaaacaagagtgaacaat
ttccttaagaaaaaagaagcaggcgctggtgaagttgctatacgtgtagtgtctagttca
gataaaatagttgaagtaaaacctgggatgcgtagtcgctttgttgataatggagagatg
ataggcgaatttccttacagggcaaaagcactttatgcatttgaagaaattgatggaact
gatgtttgcttctttggtatgcatgtccaagaatatggatctgaagctccgtcacccaat
acaagaagagtttatattgcatatttagattctgtcaactttttcaggcccaaacagtac
agaacgtatgtttatcatgaaatattattgggttaccttgattatgtaaaacaattagga
tatactatggctcacatttgggcatgccctccatctgaaggtgacgattacatatttcat
tgtcatccacctgaacaaaaaataccaaaaccaaaacgattacaagaatggtataagaaa
atgctagataagggtataattgaacgcataattctggactataaagatattttaaagcaa
gctattgaggataaattaagttcagcagcagaattaccttactttgaaggcgatttttgg
ccaaatgctttagaagatagcattaaagaacttgaccaagaagaagaacagaagcgtaaa
ctagccgaggctgaagaatctgttgaaatgtgtgtaagtgatgaagttgaaattggccct
gacggaaagaaaaaaggtatgcaaaagtccaaaaaatcaaacaaatctaagtccagccag
agaaagagcagttcaaagaaaactatgttacctcaaactagcagtgatctttctgctaaa
atttttgacaatatggataaacataaagaagtgttttttgtaattagattgcatagtgta
cagtcggctgcagcgttaggagcaatacaagatccagatcctttaatcagctgtgattta
atggacggtagagatgcatttttgaccatggctcgagaaaaacactatgaattttcatca
cttaggagagcaaagttttcttcaatggcaatgttgtatgaactccataatcaaggacaa
gataaatttgtttacacatgtaatagttgtaaatcacatgtggaaaccagataccactgc
actgtttgcgatgattttgatttatgtattacctgttacgataaagaaaaacatccacat
accatggagaaattgggtcttgatttggatgacggatcatctcctggtgaccaaaaacaa
gcagatcctcaagaagctagaaaattatctatccgccggtgtatattatcacttgtacat
gcttgccaatgtagggatgcaaattgtcgcttggcaagttgtcaacgtatgaaaagggtg
gtacaacatgttaaactatgtaaagtcaaatctaatggcaactgtccgatttgtaaacaa
tatattgcactttgctttcatcatgctaagtattgtactgaagctaagtgtccagtgttg
ttctgtccaaatatgaaacacaagatcaaacagcaacaacttcaacaaagactgcaacaa
gcacagctattaagaagacgtatggctattatgaatactggtactttagggacggaaaat
accactcctgttgtagcaacacaacatatgtctaatcaaactaaaatgatacctcataaa
gggccagttatggtcccagggaaacaaacaccgcctgccaatgttttacaagtagttaag
caagtacaagaagaagcggcacgacaacatgataacgtgggatatggaaaaggtggtcct
caacaacagatgcaacgaccacatatgcagatcgctccccctgttccacaacaagtcaat
caatgggttactgaacctaattacaatcaaatgatgatgcagcagcaacaacagcaacaa
caacaacaacaacaacaacaacaacaacaacaacaacaacaacagcagcagcaacagcag
cagcaacaacagcagcagcaacaacaagttcaacagcagcagcaaagacaaatgaacatt
caacctcaacaacaaatgatactcaataacccacaaaatccaatgcttcaacagcaacaa
gttatgacctccagacctcaaggttaccaacaaaaccctaatcaacaagtacctaaccaa
tctttacaacagttactaaatgcactgcgcaccaacactgacagtccacctgaacagcaa
caacgcctaagagagattctgaggagcaacccacagctgttggcccaattcattaggaac
caacgacaaaggcaaatgttccaacaacagcaacagcaacagggcggtgcaatcgctcct
ccaatgtatcctcaacagatgcaagggcaaccacagccaggaccgcagggtcctaaccag
cctcaatcaaatatgcaaaaccgaatgcacctataa

DBGET integrated database retrieval system