KEGG   Acyrthosiphon pisum (pea aphid): 100162131Help
Entry
100162131         CDS       T01076                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:api00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:api04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:api04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:api04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1097 aa AA seqDB search
MTKKFEFNWQIPVPDVLLQGCLFDRWSEEKDNVEIENGCLFKVDEYGFFIYWKSENRDGD
VIELCQVSDIRSGGLPKDTRQQQQLINKHGDTLEEKSLTICSNTDYININYQHVICPDAA
TAKQWQEGLRKITHNNKMNNVCVRTNLMKHWMRLGMLVDPKGKVPVKVIARTFASGKTEK
MVYQCLADLNLPSGKNDTIEPSDFTFDKFYELYHKICPRNDIEELFQSITQGKAENISLD
QFITFLNEKQRDPRLNEILYPLYDEKRALEIITDYEPSEEVKNEKQLSKEGLIRYLMSDE
NAPVFLDRLEFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRCVELD
CWDGKGEEEEPIITHGKAMCTDILFKDVIYAIRDTAFVTSDYPIILSFENHCCKSQQYKL
AKYCDEILGDLLMRECLPDFPCDPGVPLPPPSLLKRKIMIKNKRLKTEVEKSELELFRKG
QFVIEDEEKEDATAVTSNPPEEKKVEVPDVGTGTEGAEAPPPIQYTGSTTNVHPWLSSMV
NYAQPIKFQGFDVAEKKNIHHNMSSFAENTGLGYLKSQAIEFVNYNKRQMSRIYPKGTRA
DSSNYMPQVFWNAGCQMVSLNFQTADLPMQLNQGKFEYNGNCGYLLKPDFMRRADRSFDP
FAESPVDGVIAAQCSVQVIAGQFLSDKKVGTYVEVDMYGLPTDTIRKEFRTRMVPSNGLN
PVYNEEPFLFRKVVLPDLAVLRIGVYEENGKLLGQRILPLDGLQAGYRHISLRSEANFPM
ALPMLFCNIELKIYVPDGFEDFMAALSDPRAFLSAQEKRAQQMKAMGIEETDINTKDILA
GNAGEGEKTGKKGSKNKKSDEPKKEEEIKFENINLEYLRNDKGFQKARRKQEKELETLRK
RQAKEKSAIQKHQCTSVEKAVKGKDKTEVINDGGVKKLVTEQMTQWSEMVERHRREKWAL
QKQQATEQQDALIKLMETLQAAQMKQLEVRHEKDLKEMNTRQAKISVEVMKEVMNDKTLK
TKGDKDRRLREKKQNNTKKFMDERKYAQIKQAKDKDKLQAKHEKQKQELVKEINNLLEMY
KNEEIEYELSNKTEFFV
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaatttgagttcaattggcagatcccagttcctgatgtgttgctacagggt
tgtttgttcgaccgctggtctgaagaaaaagacaacgttgaaatcgaaaatggctgttta
tttaaggttgacgaatatggatttttcatctattggaaaagcgaaaatcgagatggagac
gtcattgagttatgccaggtcagtgacatacgctctggaggattacctaaagatacccga
caacagcagcagttgataaataaacatggcgataccttggaagagaaatccttaactata
tgcagcaacacggattacatcaacataaattatcagcatgttatttgtccagatgctgct
acagcgaaacaatggcaagaaggtcttcgtaagattacgcataacaacaaaatgaacaat
gtttgtgtacggaccaatcttatgaaacattggatgcgattaggcatgttggtggatcca
aaaggtaaagttcctgtaaaagtaatcgctagaacatttgcttcaggtaaaactgaaaaa
atggtttaccagtgtctggctgatctcaacttgcctagtggaaaaaatgatactattgag
ccatcagatttcacttttgataaattctatgaactttatcacaagatatgccctagaaat
gatattgaagaacttttccagtcaattactcaaggaaaagctgaaaatatcagtttggat
cagtttattaccttcctaaatgagaaacaacgagatcctcgtttaaacgaaatattatac
cctttgtatgatgaaaagagagcacttgaaattatcacagactatgaaccatctgaagag
gtgaagaatgaaaagcaattatcaaaagaaggtctcataagatatttgatgtctgatgaa
aatgcaccagtgtttttggatcgattagaattctacatggatatggatcaacctttagct
cattattatattaattcatctcataacacatatttatctggacgccaatttggcggaaag
tctagtgtcgaaatgtatcgtcaaacacttttagctggatgcagatgtgttgaactcgat
tgttgggatggtaaaggtgaagaagaagaaccaattattacccacgggaaagccatgtgt
acagatattctatttaaggatgtaatttatgctattcgagatacagcattcgtaacatct
gactatccaattattttatcgtttgagaatcattgttgcaagagtcaacaatacaaactt
gccaaatattgtgatgaaattcttggagatttattgatgagagaatgcttacctgatttt
ccatgtgatccaggagttccattacctcccccatcattacttaaaaggaaaattatgatt
aaaaataaacgattaaagacagaagttgaaaaaagtgagttagagctgtttagaaaaggt
cagtttgtcattgaagatgaagaaaaagaagatgcaactgctgtgacttcaaatccacct
gaagaaaaaaaggttgaagtacccgatgtaggaacaggtactgaaggcgccgaggctcca
ccaccaatacaatatactggttcaactacaaatgtacatccatggttatcttcaatggtt
aattatgctcagcctatcaagtttcaaggttttgatgtagctgaaaaaaagaatattcat
cataacatgagttcctttgctgaaaacaccggacttggatatttgaaatctcaagcaatt
gaatttgtaaactacaataaaagacagatgagccgtatatatccaaaaggaacccgtgct
gattcttcaaactatatgccacaagttttttggaatgctggttgtcaaatggtatcatta
aattttcaaactgctgacttgcctatgcaacttaatcagggaaaatttgaatacaatggt
aactgtggatacttattgaaaccagatttcatgcgcagagcagaccgaagcttcgatcca
tttgcagaatcccctgtagatggtgtgattgctgcccagtgttcagttcaagtgattgct
ggccaatttttgtctgacaagaaggttggtacttacgttgaagttgatatgtatggcctt
cctacagatactatacgtaaagaattccgtacccggatggtacctagcaatggtttgaat
ccagtctacaatgaagaaccatttttatttagaaaggtagtgttaccagatttagcagtt
ctgaggattggtgtgtatgaagaaaatggaaaactactgggacaaagaattttgcctttg
gatggtctacaagctggttataggcatatatcattgagatcagaagcaaatttcccaatg
gctcttcctatgttattctgtaacattgaattgaaaatttatgttcctgatggttttgaa
gatttcatggctgctttatctgatccaagagcatttttgtcagcacaagaaaagcgtgcg
caacagatgaaggcaatgggtatcgaagaaaccgatataaacaccaaagatattttagct
ggtaatgcaggagaaggcgagaagactggtaaaaaggggagcaaaaacaaaaagtctgat
gaaccaaagaaagaggaagaaattaaattcgaaaatataaacctcgagtacctgagaaat
gacaaagggtttcaaaaagcaagacgaaagcaagaaaaagaattagagactttacgcaag
cgacaagctaaggaaaagtctgctatacaaaaacaccaatgtacatctgtggaaaaggcc
gttaaaggcaaagacaaaactgaagtgatcaatgatggtggtgttaaaaaattggtgact
gagcaaatgactcagtggtctgaaatggttgaacgtcataggcgagagaaatgggcgtta
caaaaacagcaagctactgaacaacaggatgccctcataaaacttatggagaccctccaa
gctgcacaaatgaagcagttggaagttcgtcacgaaaaagatttgaaagagatgaataca
agacaggcaaaaatatctgtggaagtgatgaaagaagtgatgaacgataaaacattgaaa
actaaaggtgataaagacagacgattaagagaaaaaaaacaaaacaacactaaaaaattc
atggacgagaggaaatatgctcagattaaacaagctaaagataaggataagttgcaggcg
aaacacgagaagcaaaagcaagagttggttaaagaaataaacaatcttttggagatgtac
aagaacgaggagatcgagtacgagctgagcaacaagactgagtttttcgtatga

DBGET integrated database retrieval system