KEGG   Acyrthosiphon pisum (pea aphid): 100162140Help
Entry
100162140         CDS       T01076                                 

Definition
annulin-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100162140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 746 aa AA seqDB search
MTDCFGLCRLFEREHSSDKMGNDLPKPNENYVVVPTGDNMIRRTPNTTGMGPLNLEWINY
CFVKNGQKHRTDKYYCMYERNPTLVVRRGFPICFYLKFDREFDMANDSVSFMFKLAETGD
ANFGNNTMAAVPLKDNPSNGNGHWSAYVMSTDDVDPNVVSVRITPPNNCIVGQWIFDIDT
RSGQEAAMFSAKGNPIYILFNPWCPTDEVYLKDDALRDEYVLSEEGLMWRGSHNRQKEVM
WKYGQFQKNMLESSFLLLLKIRRLALIHCSDPIKVSRSLSAAVNAPDELGVVQGNWTEDF
SGGTAPINWLGSVDILNQYIKTKKPVKYGQCWVYAGVLTTVCRAIGIPCRPVTAYCAAHD
TQNSLTIDYLVDDDGKIIEELQTDSIWNYHVWNEVWMARPDLNILDRSWQVIDATPQELS
EGQFKCGPASVTAVKNGDIRAPYDTAFVYSEVNADKVYWRYYGISQPMKLLRKDTEAIGK
LICTKAVGKWEQENITDNYKYPEKSTEERITMHKALKQNNSIFSRYYLNEDFNEIKFDFE
LVDDIIVGENFRVAVRITNKGHKDYTVKVILRVDTVDYTGKNGSLVTKVEQQKVVLHDPG
SNVEFVQTALTYFDYGNDVKSQNVFNISCLASVVDTDYEYFGQDDFRVRKPDIEFEMHDK
PAMSREVRATVKFRNPLPLSLKDGKFFIAGSSLPKTLEIKVGKVSAKKTTSVSFKFTPQF
TGKQVISAKFTSKQLQDVDGYLQFMV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgacggattgtttcggactatgccggttattcgaacgggaacactcgagcgacaagatg
ggtaacgatctgcctaaaccgaacgagaattacgtagtggtaccgaccggtgacaacatg
attcgccgaacaccaaatacgactggcatgggtccattaaatctagaatggattaactac
tgcttcgtaaaaaacggacaaaaacacaggaccgataagtattattgtatgtacgaaagg
aatccaactttggtggtacgcagaggatttcctatttgcttttacttgaaattcgacaga
gagtttgacatggctaatgacagtgtgtcgtttatgttcaaattggctgaaactggagat
gcaaactttggaaataacactatggctgctgtgcccttaaaggataatccaagcaatggc
aatggccattggtcagcgtacgtgatgtctactgatgacgtggacccaaacgtagtcagc
gttagaattactccaccgaataactgcattgtgggacaatggatatttgacatagacacc
cgatcgggacaagaagcagctatgttctcagctaaaggaaatccgatttacatactgttc
aatccatggtgtccaacggatgaagtttatctaaaggacgatgcgctacgtgacgaatac
gtattgagcgaggaaggactcatgtggcgcggaagtcacaaccggcagaaagaagtcatg
tggaaatacggccagtttcaaaagaacatgttggaaagcagttttttgttattgttaaaa
atcagacggttagcacttatacactgcagtgacccaataaaagtatcaagaagcctatca
gccgcggtaaacgcccctgatgagttaggtgtcgttcaaggcaactggaccgaagatttt
tccggcggcaccgcacccattaattggctgggaagcgtagacattttaaatcaatacatt
aaaacaaaaaaacctgtcaaatacgggcaatgctgggtctacgctggagtactaactaca
gtgtgcagagctatcggaataccttgccgtccggtgaccgcatattgcgcagctcacgat
acacaaaatagtttgacgatcgattacttagtcgacgacgatggaaaaataatagaagaa
ctgcaaactgattcaatttggaactatcacgtgtggaacgaggtttggatggccaggcct
gatctgaacattttggaccggagctggcaagtgatcgatgccacaccgcaagagctgagc
gaaggccagttcaaatgtggcccagccagcgttacggctgttaaaaatggtgacataaga
gcaccgtacgacacggcgttcgtgtactccgaggtgaacgcagacaaggtgtactggaga
tactatggcatatctcaaccaatgaagctgttgaggaaggacacggaagcaataggcaaa
ctaatatgtacgaaagcggttggaaaatgggaacaggaaaacattacggacaactacaaa
tatcctgaaaagtcaactgaagaaaggatcactatgcataaagcattaaaacaaaataac
agtatatttagccgttattatttaaatgaggatttcaatgaaatcaaatttgattttgag
ttagtcgatgatattatcgtgggagaaaacttcagggtagcggtgagaatcacgaacaaa
ggtcataaagattacacagtaaaagttatattgcgggtcgatacggttgattataccggt
aaaaatggatctcttgtcaccaaagtcgaacaacaaaaagtagtacttcacgatccagga
tcaaacgttgaatttgtccaaaccgcgttgacgtattttgattatggtaacgatgtaaaa
agccaaaatgttttcaacatatcatgtctggcgagtgtggtcgacacagattacgagtac
ttcggacaggacgactttagggttagaaaaccggatattgaattcgaaatgcatgataaa
cctgccatgtcacgtgaagttcgggctactgtaaagtttagaaatccgttgcccctgtct
ttgaaagatggaaaattcttcatcgctggttcatcgttacctaaaactctggaaatcaaa
gttggtaaagtcagcgcaaaaaaaacgaccagtgtgtcgttcaaattcactccacaattc
accggaaagcaagtaatttctgcaaaatttacgtccaaacaactgcaagacgtcgatggt
tatttacaatttatggtgtaa

DBGET integrated database retrieval system