KEGG   Acyrthosiphon pisum (pea aphid): 100162331Help
Entry
100162331         CDS       T01076                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100162331
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100162331
  Amino acid metabolism
   00310 Lysine degradation
    100162331
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100162331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 484 aa AA seqDB search
MAYGMLHVVRGLPKNALKTTAAARRTAQFEVSNETRRVHRGNETACPRRRLSIVATSSIS
PISLSSSSNRRSFDQCRYFQTSAILWEEHVLKTPAFADSVSEGDMRWEKNVGDTVAVDEV
VCEIETDKTSVPVPSPVNGIVAQRLVEDGATVKAGQDLCTITITEGGPAPAKAAPKVEAT
PKVEDTPKAAEPVPPVAVAAAAPVPATPPPQVSQPPPPRVAAPPAAAPKMSQQQTATVKV
PPTDPTKEIAGTRSEHRVKMNRMRLRIAQRLKDAQNTNAMLTTFNEIDMSSIMDFRKTNL
DTFQKKHGLKLGFMSAFLKASAYALQDQPVVNAVIEGNEIIYRDYVDISVAVATPKGLLV
PVVRNVQDMNYADIEKTIAALGEKAKRGAIDVEDMDGGTFTVSNGGVFGSLMGTPIINPP
QSAILGMHGIFERPIAVKGQVVIRPMMYIALTYDHRLVDGREAVLFLRKIKAAIEDPRII
VAGL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcctacggtatgttgcacgtcgtcaggggtctccctaagaacgcactgaagacaact
gctgccgccagacggacggcccagttcgaagtctccaacgaaacacgaagggtccacaga
gggaacgagaccgcctgtccaaggaggagattgtcaatagttgctacatcttccattagt
ccgatatcactttctagttcatccaatagaaggtcttttgatcaatgtcgctatttccaa
acaagtgcaatcctctgggaagaacatgttttaaagacaccagcttttgctgattcagta
tccgaaggtgacatgagatgggaaaaaaatgttggcgacacagtagcagtagatgaagtt
gtttgtgaaatcgaaacagataaaacttcagttcctgttccctcaccagtcaacggaatt
gttgcacagcgacttgttgaagatggtgctactgtcaaagctggacaagatttgtgtaca
attacaatcacggaaggaggacctgcaccagccaaagcagctcctaaagttgaagctact
cctaaggttgaagatacccctaaagctgctgaaccggtaccacctgtggctgtagcggca
gctgctcctgttcctgcaacacctccaccacaagtatcacagcccccaccaccaagagta
gctgcaccaccagcagccgcccctaaaatgtctcaacaacaaactgccactgttaaagta
ccaccaactgatcctaccaaagagatagctggaaccagatcagaacaccgtgttaaaatg
aaccgtatgagattacgtattgcccaacgattgaaggatgctcaaaacactaatgccatg
ttgaccacttttaatgagatagacatgagctcgattatggatttccgaaaaactaacctt
gacacttttcaaaagaaacacggtttgaaattaggttttatgtctgcattcttaaaagcg
tctgcttatgccctacaagatcaacccgttgtcaatgctgtaatagaaggcaacgaaatt
atctacagagattatgtagatatatctgtagctgtagcaactcctaaaggtctattggtg
cctgtcgtgcgcaatgtacaagacatgaattatgcagatattgaaaaaacaattgctgct
ctcggtgaaaaagcgaaaagaggtgctatcgacgttgaagacatggacggaggtactttt
actgtcagtaatggtggagttttcggatctctaatgggaacaccaatcatcaatccacca
caatctgctattttgggaatgcatggaatttttgaaaggcctattgctgttaaaggacag
gttgtcataagacccatgatgtacatagccttaacatacgatcatagacttgtagatgga
cgtgaagctgtactattcttacgcaaaattaaagctgccatcgaagaccctagaataatt
gttgcaggattataa

DBGET integrated database retrieval system