KEGG   Acyrthosiphon pisum (pea aphid): 100162331Help
Entry
100162331         CDS       T01076                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100162331
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100162331
  Amino acid metabolism
   00310 Lysine degradation
    100162331
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100162331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 484 aa AA seqDB search
MAYGMLHVVRGLPKNALKTTAAARRTAQFEVSNETRRVHRGNETACPRRRLSIVATSSIS
PISLSSSSNRRSFDQCRYFQTSAILWEEHVLKTPAFADSVSEGDMRWEKNVGDTVAVDEV
VCEIETDKTSVPVPSPVNGIVAQRLVEDGATVKAGQDLCTITITEGGPAPAKAAPKVEAT
PKVEDTPKAAEPVPPVAVAAAAPVPATPPPQVSQPPPPRVAAPPAAAPKMSQQQTATVKV
PPTDPTKEIAGTRSEHRVKMNRMRLRIAQRLKDAQNTNAMLTTFNEIDMSSIMDFRKTNL
DTFQKKHGLKLGFMSAFLKASAYALQDQPVVNAVIEGNEIIYRDYVDISVAVATPKGLLV
PVVRNVQDMNYADIEKTIAALGEKAKRGAIDVEDMDGGTFTVSNGGVFGSLMGTPIINPP
QSAILGMHGIFERPIAVKGQVVIRPMMYIALTYDHRLVDGREAVLFLRKIKAAIEDPRII
VAGL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcctacggtatgttgcacgtcgtcaggggtctccctaagaacgcactgaagacaact
gctgccgccagacggacggcccagttcgaagtctccaacgaaacacgaagggtccacaga
gggaacgagaccgcctgtccaaggaggagattgtcaatagttgctacatcttccattagt
ccgatatcactttctagttcatccaatagaaggtcttttgatcaatgtcgctatttccaa
acaagtgcaatcctctgggaagaacatgttttaaagacaccagcttttgctgattcagta
tccgaaggtgacatgagatgggaaaaaaatgttggcgacacagtagcagtagatgaagtt
gtttgtgaaatcgaaacagataaaacttcagttcctgttccctcaccagtcaacggaatt
gttgcacagcgacttgttgaagatggtgctactgtcaaagctggacaagatttgtgtaca
attacaatcacggaaggaggacctgcaccagccaaagcagctcctaaagttgaagctact
cctaaggttgaagatacccctaaagctgctgaaccggtaccacctgtggctgtagcggca
gctgctcctgttcctgcaacacctccaccacaagtatcacagcccccaccaccaagagta
gctgcaccaccagcagccgcccctaaaatgtctcaacaacaaactgccactgttaaagta
ccaccaactgatcctaccaaagagatagctggaaccagatcagaacaccgtgttaaaatg
aaccgtatgagattacgtattgcccaacgattgaaggatgctcaaaacactaatgccatg
ttgaccacttttaatgagatagacatgagctcgattatggatttccgaaaaactaacctt
gacacttttcaaaagaaacacggtttgaaattaggttttatgtctgcattcttaaaagcg
tctgcttatgccctacaagatcaacccgttgtcaatgctgtaatagaaggcaacgaaatt
atctacagagattatgtagatatatctgtagctgtagcaactcctaaaggtctattggtg
cctgtcgtgcgcaatgtacaagacatgaattatgcagatattgaaaaaacaattgctgct
ctcggtgaaaaagcgaaaagaggtgctatcgacgttgaagacatggacggaggtactttt
actgtcagtaatggtggagttttcggatctctaatgggaacaccaatcatcaatccacca
caatctgctattttgggaatgcatggaatttttgaaaggcctattgctgttaaaggacag
gttgtcataagacccatgatgtacatagccttaacatacgatcatagacttgtagatgga
cgtgaagctgtactattcttacgcaaaattaaagctgccatcgaagaccctagaataatt
gttgcaggattataa

DBGET integrated database retrieval system