KEGG   Acyrthosiphon pisum (pea aphid): 100162498Help
Entry
100162498         CDS       T01076                                 

Definition
(RefSeq) aldose 1-epimerase-like
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00052  Galactose metabolism
api01100  Metabolic pathways
Module
api_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100162498
   00052 Galactose metabolism
    100162498
Enzymes [BR:api01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100162498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100162498
NCBI-ProteinID: XP_001947733
APHIDBASE: ACYPI003648
UniProt: J9JTJ2
Position
Un
AA seq 468 aa AA seqDB search
MDGSKKHSLETMLLNPISVDALNDIIYESEEQQKSVYDSGHIIVDNYGCIKDDNGQNVRV
TKYTLKNEHKVVIEIINYGATVISCWVPNSQGELEDVLLGFDSIEDYKLHNTHSIGGTLG
RVTDYISNGHLENENGEIYELIKNRDGHHFNGGEKGFDKVMWDGYVADDELVLTYSSKDG
EEGYPGTFQARITFRLTCKNELVVNYVGMTSKSTPVNMASNMFFNLAGQNTGESELMNHS
IMVNAEEYVAIKQPERRPVGLIKNVHYTCLDLRVPRLLKKAFPLVPGFGYNHTFKLFKGK
DRKAFNLAASLVHKQSGRLLDIYTDMPCIHVNTAQDFPNYGKPLFKEEVLKVTNIEAPLA
KFNKYENEQESFISEEYKFASDAELVEEEHNLDYDIKHSSTHVNHVQEIKPIKGKCNTIY
NKHSGICIRPQLFPDAVTHKNFNSITLKPSNMYSQQVIYKFGVIASTA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatggttcaaaaaaacattctttagagactatgttgttaaatccaataagtgttgat
gcattgaatgatataatttatgaatcagaagaacagcaaaaaagtgtttatgatagtggt
cacataattgtagacaactatggatgcataaaagatgataatggacaaaatgtcagagtg
acaaaatatactttaaagaatgaacataaagttgttattgaaatcattaattacggtgct
accgttatttcctgctgggtaccaaattcacagggcgaactagaagatgttttacttggt
tttgactcaattgaagactataagttacacaacacacactccattggtggtacattaggc
agagtaacagattatattagtaatggtcatctcgaaaatgaaaatggtgaaatatatgaa
ctaatcaaaaatcgtgatggtcatcacttcaatggtggtgaaaaaggatttgataaggtc
atgtgggatgggtatgtggcagatgatgaactggtattaacttattcgagtaaagatggt
gaggaaggctatccaggaacatttcaagctcgtataacatttcgtttgacttgcaaaaat
gaattagttgtaaactacgttggtatgacatcaaaatcaactccagtaaatatggcctca
aatatgttcttcaatttagctggacaaaacaccggagagtctgaactcatgaatcattca
attatggtcaatgccgaagaatacgtggcaataaaacaaccagagcgaagacctgttggc
ttgattaaaaatgtgcattacacatgtcttgacttgcgtgttccaagattattaaaaaaa
gcttttcctcttgttcctggttttggatacaatcatacattcaaattgttcaaaggaaaa
gaccgaaaagcatttaatctagcagccagcttagtacataaacaaagtggtcgcttgttg
gatatttacacggatatgccttgtatccatgtaaatactgctcaagattttcccaattat
ggtaaaccgttattcaaagaagaggttctgaaggtaaccaatatagaagcaccgttagca
aaatttaataaatatgaaaatgaacaagaaagttttatctctgaagaatataaatttgcg
agtgacgcagaactagtagaagaagaacacaatttagattatgacatcaaacattcttca
acccatgttaaccatgtacaggaaatcaagcccatcaaaggaaaatgtaatactatatat
aacaagcattctggaatttgcatacgtcctcaactatttccagatgccgttacacataaa
aacttcaacagtattactctcaaaccatcaaatatgtatagccagcaagtcatttataaa
tttggagttattgcttcaactgcttaa

DBGET integrated database retrieval system