KEGG   Acyrthosiphon pisum (pea aphid): 100162534Help
Entry
100162534         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100162534
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100162534
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100162534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 650 aa AA seqDB search
MTVLSSAETAEQPPRKKLCLSASRQLQSKSYALSQLNPMASPLDQPVIRHIKQQQQLQQQ
QQQQQQINCSCDNESNGSPGVATLCNLGNTCFLNSVLYTLRFAPSFLHNLHHLITELQEI
TGRSTNGLKGKCSSLGRSTSSVSSKMWNFQSSLNVSMNDLKIIQVTERLHQVFEALHNCE
LKDSSDPYQPEVFLQSLRDVNPIFEGNQQHDAHELLVCLLDNIREGCKLVMQHSAQVNCF
VAPAPVIQPVAPNKLKKFSGQVRKSLKIASSSKTRPVNGILPPSVNIASDKVVLPENDNF
ADDKQMYVVNGTTNAVQSDENESIPNGSSSSSTSMFDDFQGVSLLRTTCLECEFVTERKE
SFCDICVPINGLTNGDISPENEFNPYDYDSVNKLYHSAIVTEEYLQDTDKYWCEQCCRYN
EAKRSVGYESLPRLLTLHLKRFCTNYRAVVSKVNEHMPTPLTLECFCEECLSLNSQQKTR
AHSYQLYAIIMHLGATIASGHYVAYVKAQDNLDEYINCPRDRRKTGSLSVTPNGTLPANY
KKSSISNGLFRFLKISSKTSSSGAPNSQSSDSIDSGKVSSIGRWCRSLECCGVRILDNSE
GGDSVWLECDDETVRTMSVAQLTQILESKSSKNSALTPYLLFYVKVNHSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttatcgtcagcagagacagctgaacagccgccacgcaagaagttgtgttta
tcagcatccaggcaactacaatctaaatcctatgcactctcccaacttaacccgatggca
tcacctcttgaccagcctgttatccggcatatcaagcaacagcaacaactgcagcagcaa
cagcagcagcagcagcaaataaactgttcttgtgacaacgaaagcaatgggtcccctggt
gtggcaactttatgcaatcttggtaacacctgttttctgaatagtgtcttgtacacattg
agatttgcaccttcatttttgcacaatcttcatcaccttattaccgagttacaagagatc
acggggcggtcaacaaacggactcaaaggaaaatgttcgtctctgggtagaagtacaagc
tcagttagcagcaaaatgtggaactttcaatcatcattaaatgttagtatgaatgatcta
aaaatcatacaagttactgaacgtcttcatcaagtattcgaagcattacataattgtgag
ctcaaagacagttcagatccatatcaacctgaagtatttttgcaatccttaagagacgtc
aatccaatttttgagggaaaccaacaacatgacgcccatgaactactcgtctgcttgtta
gataatatcagagagggatgtaaattagtcatgcagcattctgcccaagtgaattgtttt
gtagcacctgctccagtcattcaaccagttgcgcctaataaattgaaaaaattttctgga
caagtgcggaagtctttaaaaattgcatccagtagtaaaacacgaccagttaatggaatt
ctcccgcccagtgttaatattgctagtgataaagtggttttacctgaaaacgacaatttt
gctgatgacaaacaaatgtatgtagtaaatggaactacaaatgcagtccaatctgatgaa
aatgaaagcattcctaatggcagcagtagtagcagtacatcaatgtttgatgattttcaa
ggtgtatccctacttcgcaccacttgtttagaatgtgaatttgttacagaacggaaagag
agtttttgtgacatctgtgttcctataaatggtttaactaatggagacatatcacctgaa
aatgaattcaacccctatgattatgacagcgtaaacaaattgtaccattctgcaatagta
actgaagaatatttacaagacactgacaaatattggtgcgaacagtgttgtcgatataat
gaagctaaacgaagtgttggatatgaaagtttacctcgactgctgacattacatttaaaa
cgattttgcaccaactatagagctgttgtgtcaaaagtaaatgaacacatgccaacacct
ttaacattggagtgtttttgtgaagagtgtttatctctcaattcacaacaaaaaactcga
gcgcatagttaccagctgtatgctataataatgcatttgggtgctacaattgcgtctggg
cattatgtcgcatatgttaaggctcaggacaaccttgacgagtatatcaattgtcctcgt
gatcgacgcaagactggaagcctttccgtcacacccaatggtactttgccagcaaattat
aaaaagtcatcaatatcaaatggtcttttccgatttctaaaaatatcttcaaaaacgtca
tcatctggtgctcctaatagtcagtcaagtgattcaattgattcaggaaaagtttcttcg
ataggacggtggtgccgtagtctagaatgttgtggagtaagaatattagataattcagaa
ggtggagacagtgtgtggttagagtgtgatgatgaaacagtgagaacaatgtcggttgca
caattaacacaaattttagaatccaaatcatccaagaactcagcactaactccatactta
ttattttatgttaaagtgaatcacagcgaataa

DBGET integrated database retrieval system