KEGG   Acyrthosiphon pisum (pea aphid): 100162552Help
Entry
100162552         CDS       T01076                                 

Definition
filamin-A
Orthology
K04437  
filamin
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100162552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2355 aa AA seqDB search
MSAVAAVAAAAPTATDDPDGYEAGSQEDDMGAAERDLAEDARWKLIQQNTFTRWANEHLK
TAGKAIGNLETDLGDGLRLIALIEVLSGKRLPKHNKRPTFRSQKLENVSVALKFLDDENI
KLVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEFGGEQVPNEKGATPKQRLLNW
IQSKVPDIPISNFTTDWNDGKAVGALVDAVAPGLCPDWQDWKSNNALKNASEAMGLADDW
LNIKQLIKPEELVSPNMDEQSMMTYLSQYPNAKLKQGAPIRSKTNPSRVRVYGPGIEPSG
PAVGAKTNFTVETFSAGKGTVNVSVENPKGKAEPVDLVFNNDRSQTYTATYKPVVEGPHK
VHVNFSGVPTPKSPYHVNVDASAGDPNKVNVFGPGIQPEGVFTNRPTYFEIHTKDAGKGV
PEVIILDPAGRENTIPVKLKKEPNGVYICDYTPVVQGVHSVNVFFANQPVPLSPFAVGIS
NASDAKRVRAFGRGIQPHGLRVQDEAKFKIVTEGAGEGVPDVNVIGPGGVKEPVNMKKLD
AHTYEATYYPRKVGRHVVMVTFGGVEIPKAPFEVHVNPFKETLIRAYGPGLTGGVVSHPA
MFTVETNGETGSLGFSIEGPSKAKIDCHDNGDGSADVRYYPMAPGEYAVHILCDNEDIPK
SPYMANVVPSSDIYPDKVNCYGSGLQPNGVIQGKPAEFVVDTKKAGVAPLDVKVIDSSGN
FVEPVLKDNKDGTFSCKYVPKSIGKHTLQVSYGGVAVPKSPFRVFVSQPLNANKVQIFGP
GIESGVKTNKPNHFTIDCSDAGIGELNVNLVNDKGVNVPLQVNDNEDGSFLIDYVPTNSG
VHKLNCTYGGVKVPDCPIKINVQSPVDLSKVKVDGLETLAPVNSLQQFRVMTREAGRAEF
AVVITGPSGGSVTAHVVPVADGYVVNFTPTEVGEYRLSVTLGGEQAGRPYRMTCTRASDP
GKVTAHGPGLAGGPVNRPAEFTIDTKRAGQGGLGVTVEGPCEAAINCRDNGDGTCSVAYM
PVEAGHYVVNITFDDHPIPGSPFNALVGGRAAGDAPRPPNNVKASGNGLLANGVLLGSPT
DFSVDSRAVAKYGQGVVTCTVTNPSGTRTETFITPQSDGTYKISYTPFEAGPHTIDIYYD
GVPIVGSPFSVNVRRGTDASKCRAFGPGVSHGIIHKVNTFTVETKGAGTGSLGLAIEGPS
EAKMTCVDNRDGSCTIEYTPTESGVYDVSIQFAETHIPGSPFKVQVDRPDRPATVNDIKV
SGPGINPKYIRANTPITFKVDASKSAKGHVDVKMGNDKGVLQSKQPIIRDNEDGTYDVTY
TPNPEGAELVANVLYNGHHVPNSPFKFRVRPKFELDKIKIEGPGVSDSRGIKASVPTYFV
VDATDAGSGKLDLRIMGPDGFPRQVDIEKKDNIYKIKYTPDDCGRYTIEALYDGKPLPQS
PIQVQAYSTGNVTEDTVGVKRLPRDFAEQLRFDEYAQQTITTTSKTTSTTTDEYRPVALD
KIPVPSCGGHLTADIAMPSGKRDQPSVEDNHDGTVSLKYDPKEEGLHELFVKYNGENVQG
SPFKFHVDSITSGHITAYGPGLMHGVSGEPSDFTIYTKGAGAGGLSLAVEGPSKADISCH
DNKDGTVSVTYLPTAPGEYRISVKFEDKHIKGSPYNTKVTGEGRKRNQISVGSCSEVSLP
GKVLDKDFRLLNASIQAPSGLEEPCFLKRLVNGNLGISFTPREIGQHVVSVKRMGQHIVN
SPFKITVGEREVGDAKKVKVTGNGLKEGKTHVENLFTVDTRSAGYGGLSLSIEGPSKAEI
QCKDNEDGTLTISYRPTEPGYYIVNLKFADHHVDGSPFTVKVTGEGSNCQREKIERRREA
VPLTEVGSNCKLTFKMPGVLPYDLSSTVTSPCGITEDAEINEIEDGLYAVHFVPKELGVH
TVSVRYKEVHIPGSPFQFTVGPMSDGGAHRVHAGGSGLERGEQGQPCEFNVWTREAGPGS
LAISVEGPSKAEIDFKDRKDGSCYVSYVVGEPGEYRIGIKFNDQHIPDSPYKLFMSPAMG
DAHKLEVAQFPTSGVQADYPAQFMVRKNGAVGQLDAKVVSPSGAEDDCFIQSIDQDMYSV
RFMPRDNGVHNIHVKFNGVHIPGSPYRLKVGKGDADPAAVHATGSGLGDVKTGHKTDFIV
DTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGEYYISLKYNGYHIVGSPFK
VTCTGEDLAERGPQETSSVVVETVHKVSKAHKGGAGVVLPHFKSNATLVTSKGMGLKKAY
VGKQNLFSISASDAGNNILFVGIYGPKGPCEEIFIKHMKQNNYQVSYIVRERGEYILLVK
WGDDHIPGSPFKIDT
NT seq 7068 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgtggcagcggtggcggcggcggcaccgaccgcgacggacgacccggacgga
tacgaagccggcagtcaggaggacgacatgggagccgccgaacgggatttggccgaggac
gcgcgctggaagctcatccagcagaacacgttcacacgatgggccaacgagcacttgaag
acggccggcaaggccatcggcaacctggaaacggacctgggagacgggctccggttgatc
gctctcatcgaagtgctcagcggcaagcggctgcccaagcacaacaaacggcccacgttc
cggtcgcagaagctggagaacgtgtccgtggcgctcaaattcctcgacgacgagaacata
aaactagtcaatatcgattcttccgatattgttgattgtaaattgaaattgattttggga
ttaatatggacattgattttacattactctatatcgatgccaatgtgggatggcgaattt
ggtggcgagcaagtaccaaacgaaaaaggagcaacaccgaaacaaagattgctgaactgg
atccagagtaaggttcccgatataccgatttcgaatttcactacagactggaacgacgga
aaggccgttggcgctttggtcgatgccgtagctccgggcttatgtccggattggcaggac
tggaaatccaacaacgcacttaaaaatgcatcggaggccatgggcttggctgacgattgg
cttaacatcaaacaactcatcaaacctgaagaattggtcagccccaacatggacgaacaa
tccatgatgacctatttgtctcagtacccgaacgcaaagttgaaacaaggagcaccgatt
agatcgaaaaccaacccgagccgcgttcgcgtttatggtcccggaatcgaaccttctgga
ccggccgtgggagccaaaacgaatttcaccgttgaaacgttttccgccggaaaaggcaca
gtcaacgtgtctgtggaaaaccccaaaggaaaagctgaaccggttgatctggttttcaac
aacgaccgaagtcaaacttacacggccacgtacaaaccggtcgtcgaaggaccgcataaa
gtgcacgtgaacttctccggggtaccgactccgaaatctccatatcacgttaatgtggat
gcgtcggctggtgatccaaacaaagtaaatgtcttcgggcctggtatacagcccgaaggc
gtgttcacgaaccgacccacttatttcgaaatccatacgaaagatgccggaaaaggtgtt
cccgaggtgataattctcgatcctgctggccgagagaacacgataccggtgaaactcaag
aaagaacctaacggagtgtatatatgcgattacacgccggtcgtccagggagtgcactct
gtcaatgttttcttcgcaaatcaacctgtgccactaagcccatttgctgtcggcatatcg
aatgcatctgacgctaaacgcgtaagagcctttggacgaggtatacaaccgcatggcctt
agagtccaagatgaagccaagttcaaaattgtcaccgagggagcaggcgaaggcgttcca
gatgtgaacgtaatcggaccgggtggagtcaaagaacccgtaaacatgaaaaaactcgac
gcacacacgtatgaagcaacgtactatccgaggaaagtcggccggcacgttgtgatggtg
acgtttggaggggtggaaatccctaaagcaccgttcgaagtgcacgtcaacccattcaag
gagactttgattcgtgcttacggacctggacttaccggaggcgtagtttcgcatccggcg
atgttcactgtcgaaaccaacggagaaaccggttcgctaggattcagtatcgaagggcca
tcaaaggcgaaaatcgattgccacgacaacggcgacggatcagcggacgtcaggtactat
cctatggcgccaggagagtatgccgtgcatatattatgtgataacgaggacatacctaag
tcaccctacatggccaacgttgtgcccagttcggatatctatcccgacaaggtgaactgt
tacggcagtggactgcaaccgaatggtgtcatacaagggaaaccggctgaattcgtggtg
gacacgaaaaaggctggagtagctccacttgacgtaaaggtcattgattcgagtggcaac
tttgtagaacccgtgttgaaagacaataaagacggtacattttcttgcaaatacgtcccg
aagtcgatcggcaaacacacgttacaggtcagttatggaggcgtcgctgtaccaaaaagt
ccgttccgcgtgttcgtgtcacagccgttgaacgcgaataaagtacaaatatttggaccc
ggtatcgaatccggcgtcaagaccaacaaacccaatcatttcaccatcgattgttccgat
gccggaatcggtgagctgaacgtgaatctggtaaacgataaaggagtcaacgtgccattg
caggtcaacgataacgaagacggttcgttcctcattgactacgtcccgaccaactcgggc
gttcacaaattgaattgcacttacggtggagtcaaggtgcctgattgcccgatcaagatc
aacgtacagtctccggtagacttgtccaaagtcaaagtggatggtctcgaaacgctggct
ccggtcaacagtctgcagcagttccgagtgatgacgcgggaagccggtagggcggaattc
gcggtggtgatcacaggcccgtccggtggttcggtgacggcgcacgtggtgcccgtcgcc
gacggttatgtggtgaacttcacgccgaccgaggtgggcgagtaccgactgagcgtgact
ctgggtggcgaacaggcgggccggccgtaccgtatgacgtgcacgcgggccagcgacccg
ggcaaggtgacggcccatgggccgggcctggccggtggcccggtcaaccggcctgccgag
ttcaccatcgacacgaaacgcgctggccagggaggcctgggcgtgacggtcgagggcccg
tgcgaggcggccatcaattgccgggataacggggacggcacgtgctcggtggcgtacatg
cccgtcgaggccggccactacgtcgtcaatatcacattcgatgaccacccgattcctggg
tcgccgttcaacgcgctggtcggtggccgggcggccggcgatgcgccgcggccgcccaac
aacgtcaaggcgtccggcaacggtctgctggccaatggcgttttattgggatcaccaact
gacttctccgtggattcacgagctgttgccaagtacggccaaggggtggttacgtgtacg
gtaactaatccatctggtaccaggacagaaacgttcataacgcctcaaagcgacggaaca
tataaaatcagttacaccccgttcgaagcaggaccacataccatcgacatttattacgac
ggcgtccccatagtcggttcaccgttttctgtgaacgtgagacgaggaactgacgcgagc
aagtgcagagcttttggaccgggtgtgagccatggaattatccacaaagtcaacactttc
accgtcgaaacaaaaggagctggcactggtagcttaggtttggccatcgaaggaccttct
gaggcgaaaatgacgtgcgttgacaatcgcgatggttcgtgtacgatcgaatacacgcct
acagaatctggtgtttacgatgtgagcattcagtttgctgaaacacacattcccggatca
ccgtttaaggtccaagtcgatcgtcctgatcgccctgcaaccgtaaatgacatcaaggtg
agcgggccaggcatcaatccaaaatatatcagggccaacacgcccatcacgttcaaagtg
gacgcttcgaagtctgctaaaggacacgtagacgtgaaaatgggaaacgacaaaggtgtg
ttacaatccaaacaaccaattattcgagacaatgaagacggtacctatgatgttacctac
actcctaatccagaaggcgctgaacttgtggccaacgtattgtacaacggacatcatgta
ccgaatagtcctttcaagttcagagttcgacctaagttcgaattggataaaatcaagatc
gaaggccccggcgtttccgactctcgaggtatcaaggcttctgttcccacgtatttcgtc
gtggacgctactgatgctggttccggaaaattggacttgagaattatgggaccggatggt
tttcccaggcaggtggacatcgaaaagaaggacaatatatataaaatcaagtatactccg
gatgactgcggtcggtacacgatcgaagcactatatgacggcaaaccattaccgcaatct
ccgattcaagtacaggcgtactccactggaaatgtcaccgaagatacggtcggggtaaaa
cggttgcccagagactttgccgagcaactgcgcttcgacgagtacgcgcaacagacgatc
accactacctccaagaccacctccaccaccaccgacgagtataggcccgtggcattggac
aagataccggtaccttcgtgcggtggacatttgacagctgatattgcgatgccgagcggt
aaacgagaccaaccgtccgtcgaggataatcacgatggaacagtttctcttaaatacgat
cccaaggaagagggcttgcatgagttgttcgttaagtacaacggagaaaacgttcaaggt
tcgccattcaaattccacgtcgactccatcaccagcggccacatcacagcttacgggccg
gggctcatgcacggcgtcagcggagaaccgtccgacttcaccatatacacgaaaggagcc
ggagccggcggtctttcgttggctgttgaaggtcccagtaaagcggacatcagttgtcac
gataacaaggacggtacggtgtctgtcacttacctgccgacggcacccggcgaatacagg
atttccgtcaagtttgaagacaagcacatcaaaggaagcccgtacaatacaaaagtcaca
ggcgagggccggaagaggaaccagatatccgtgggctcatgcagcgaggtgtcgttgccc
ggcaaagtgctggacaaagacttccggctattgaacgcgtcgatccaagccccaagtggt
ctggaagaaccttgtttcttgaaacgcctggtaaacggcaacttgggtatttcgttcacg
cctagagagattggccagcacgtagtgtccgtgaaaagaatgggccagcatatcgtcaac
tcgccgttcaagataaccgtgggcgagcgagaagtcggtgatgcaaaaaaggtgaaagtc
accggcaacggactgaaagaaggcaaaacgcacgtggagaatttgttcacagtggacacg
aggagcgctggttatggtggattatcgctttccattgaaggcccgagcaaagcagagatc
cagtgtaaggacaatgaagacggtacattgaccatatcatataggcccacggaaccggga
tactatatcgtgaatctgaagttcgccgaccatcacgttgacggttcaccgttcactgtt
aaagtcaccggcgaaggaagcaactgtcagcgtgagaagattgagcgaaggcgggaagcc
gtacctctcacagaagtgggtagcaactgcaaactcacgttcaagatgccaggtgtgttg
ccatatgatttgtcgtcgacggtgacatcgccatgtggcatcacggaagacgccgaaatc
aacgaaatcgaagacggtctctacgctgtacattttgtcccgaaggaattgggcgttcac
acggtgtcggtccggtacaaggaagtccacataccgggatcgccgttccaatttaccgtc
ggtcctatgagcgatggtggagctcaccgcgtacacgctggaggttctggtttggaacgt
ggagaacaaggacagccatgcgagtttaacgtgtggaccagagaggccggtccgggctca
ctagccatatcggttgaaggtcctagcaaggcagaaatcgatttcaaagaccgcaaggac
ggctcatgttatgtcagttacgtcgtaggcgaaccaggagaatatcgaattggtattaag
tttaacgaccagcacataccggactcaccatacaagctgtttatgtcaccagcaatgggt
gacgcgcacaagcttgaagtggcgcaattcccgacgtcgggagtccaagccgattaccca
gctcaattcatggttcgtaagaacggcgctgtcggtcaactcgatgccaaggtggtgtca
ccgtccggtgcggaagacgactgtttcatccaatcaatcgatcaagacatgtactctgtc
cgtttcatgccccgcgataatggcgttcacaacatacacgtcaagttcaacggggttcac
attccaggatcaccgtaccgcctgaaggttggcaaaggagacgccgaccctgctgccgtg
cacgccacgggcagtggtctgggagacgtcaagacaggacacaaaacggatttcattgtg
gacacttgcaacgcgggtgccggtacattggctgtaaccattgacggaccaagtaaggtt
tcgatggactgtaccgaagtcgaagaaggctacaaagtcaggtatacgccgctagtgcca
ggcgaatattacatcagtttgaaatacaacggatatcatattgttggttcgccgttcaaa
gtcacttgtactggtgaggatttggctgagcgcgggccacaagaaactagctcggtggtt
gtggaaaccgtacacaaagtgtctaaagctcacaagggtggggctggtgtcgttctgccg
cactttaagtcaaatgctacactcgtcaccagcaaaggaatgggtttgaagaaagcgtat
gtgggaaaacaaaatctgttcagcataagcgcttctgacgccggtaacaatatattattc
gttggtatttacggacccaagggaccgtgtgaagagatatttatcaaacacatgaaacag
aacaactaccaagtgagctatatcgtccgagaacgtggcgaatacattctactggtcaag
tggggcgatgatcacatacccggctcaccattcaaaatcgatacttaa

DBGET integrated database retrieval system