KEGG   Acyrthosiphon pisum (pea aphid): 100162564Help
Entry
100162564         CDS       T01076                                 

Definition
calcineurin B-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100162564
Protein phosphatases and associated proteins [BR:api01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100162564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 170 aa AA seqDB search
MGNENSLPMELCSNFDADEIRRLGKRFRKLDLDNSGALSLDEFLSLPELQQNPLVQRVID
IFDEDGNGEVDFKEFIQGVSQFSVKGDKESKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTILFADKDEDGKINFEEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaaaactcgcttccgatggaattgtgctcaaacttcgatgctgacgaaatc
agacgtttgggcaaacggttccgcaaactcgatctggacaactccggcgccttgagcttg
gacgaatttttatcactgcctgagcttcaacagaacccgcttgtccaaagagttatagac
atatttgacgaagatggcaatggtgaagtagatttcaaagagtttattcaaggagtgtct
caattcagtgttaagggagacaaagaatcaaagttgcggtttgcgtttcgaatctacgat
atggataatgatggatatatatcaaatggtgaattatttcaagttttgaaaatgatggtt
ggaaataatttaaaagatactcagctccagcaaattgtggacaaaactatattgtttgcg
gataaagatgaagatggcaagattaattttgaagagttctgttcagttgttggcaacaca
gatatacacaaaaagatggttgttgacgtttaa

DBGET integrated database retrieval system