KEGG   Acyrthosiphon pisum (pea aphid): 100162628Help
Entry
100162628         CDS       T01076                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 194 aa AA seqDB search
MFLNTIRTLSSTLFKASSGLSIGNHIVPKNGRNVYTNVVKYNELSAKDEMQRDSPKDRST
VIPAETSIEYLKSDAYKSTYGNNPVWKEYRRNHKGSIPPRKTRKTCIRSDMIATGNPCPI
CRDEYLILDYRNVDLLKQFISPYSGKLLSYKLTGICQKQHENLIVAVKKAKDWGFIKFDL
PIKHYNYDEFKNSN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaatactattcgtacattgtcgtctacacttttcaaagcatcaagtggtcta
tcaatcggcaaccacattgtgcctaaaaatggaagaaatgtctacacaaacgtggtcaaa
tataatgaattgtcagctaaagatgaaatgcaacgagattcacctaaagataggtcgact
gtgattcctgccgaaactagtattgaatatctaaaaagtgatgcatacaaatccacttat
ggaaataatcctgtatggaaagaatatcgccgtaatcacaaaggaagtattccaccaaga
aaaactaggaaaacgtgtattagatctgatatgattgctactggtaatccatgtccaata
tgtcgtgacgaatatctcatactcgactacagaaatgtggatttgctcaaacaattcata
tctccttattctggaaaattgctatcctataaattaactggaatttgccaaaaacaacat
gaaaatttgatagttgccgtaaaaaaagccaaagactggggatttattaaatttgatctt
ccaatcaaacattacaattatgatgaatttaaaaattcaaattag

DBGET integrated database retrieval system