KEGG   Acyrthosiphon pisum (pea aphid): 100162628Help
Entry
100162628         CDS       T01076                                 

Definition
28S ribosomal protein S18b, mitochondrial
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Ribosome [BR:api03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100162628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 176 aa AA seqDB search
MFLNTIRTLSSTLFKASSGLSIGNHIVPKNGRNVYTNVVKYNELSAKDEMQRDSPKDRST
VIPAETSIEYLKSDAYKSTYGNNPVWKEYRRNHKGSIPPRKTRKTCIRSDMIATGNPCPI
CRDEYLILDYRNVDLLKQFISPYSGKLLSYKLTGICQKQHENLIVAVKKSQRLGIY
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaatactattcgtacattgtcgtctacacttttcaaagcatcaagtggtcta
tcaatcggcaaccacattgtgcctaaaaatggaagaaatgtctacacaaacgtggtcaaa
tataatgaattgtcagctaaagatgaaatgcaacgagattcacctaaagataggtcgact
gtgattcctgccgaaactagtattgaatatctaaaaagtgatgcatacaaatccacttat
ggaaataatcctgtatggaaagaatatcgccgtaatcacaaaggaagtattccaccaaga
aaaactaggaaaacgtgtattagatctgatatgattgctactggtaatccatgtccaata
tgtcgtgacgaatatctcatactcgactacagaaatgtggatttgctcaaacaattcata
tctccttattctggaaaattgctatcctataaattaactggaatttgccaaaaacaacat
gaaaatttgatagttgccgtaaaaaaaagccaaagactggggatttattaa

DBGET integrated database retrieval system