KEGG   Acyrthosiphon pisum (pea aphid): 100162673Help
Entry
100162673         CDS       T01076                                 

Gene name
Rpa2
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:api03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:api03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:api03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:api03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:api03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 249 aa AA seqDB search
MWGDDEGGFNVTMTQSPTTASGVEPKQNTVISVAIRELFDSNEENKNTHVVVVGIIKQVE
TQALKNMFTIEDNTGRLLCIQWGDENELSRYPKLIENAYFKVVGSKRMQNDKVTLLCHSV
RPLETLNELTHHLLSIIALPYITEEINVASGTQQSTATNQKDFLMSGDNTNGFMDTTNNL
SLNPRQLKVYTVIKRCQDEAGYSALDIQKILPEKMPLSEIEKILSFFIEEGHIFSTIDEN
HYKVTDFGS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtgacgatgaaggtgggtttaatgtcacaatgacgcaaagtccaacaacagca
tctggagttgaaccaaaacaaaatactgtaatctctgtagctattcgtgaattgtttgat
agtaacgaggaaaacaaaaatacacatgttgtagttgttggaattatcaagcaggttgaa
acacaagcattaaagaatatgtttacaattgaagacaatactggtcgtttgttgtgcatt
caatggggagacgagaacgaattgtcaagatatccaaagttgattgaaaacgcttatttt
aaagtagttggtagtaagagaatgcaaaatgacaaagttactttgctttgtcatagtgtc
agacctttagaaactctaaatgaattaacacatcatttattaagcattattgcgttacca
tatataaccgaggaaatcaatgtggctagcggtacacaacaatctactgcaacaaaccaa
aaagactttttaatgagtggtgataatactaatggatttatggatacaactaacaattta
tcgctgaatccgaggcaattaaaagtttatacagtaataaagaggtgccaggatgaggca
ggttattcagcattagatatacaaaagatacttccagagaaaatgccattatcagaaata
gaaaaaattctttcatttttcatcgaagagggacatattttctcaaccattgatgagaat
cattacaaagtcactgatttcggaagttaa

DBGET integrated database retrieval system