KEGG   Acyrthosiphon pisum (pea aphid): 100162812Help
Entry
100162812         CDS       T01076                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100162812
  Lipid metabolism
   00600 Sphingolipid metabolism
    100162812
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100162812
   00604 Glycosphingolipid biosynthesis - ganglio series
    100162812
   00511 Other glycan degradation
    100162812
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100162812
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100162812
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100162812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 628 aa AA seqDB search
MKSREIVLRTSKPTFTVDYERNEFLKDGQVFRYVSGSLHYFRVPKPYWKDRIQKMKAAGL
NAISTYVEWSLHEPYPGEYNFDDIADLEYFLQLVKDEGMYLLLRPGPYICAERDFGGFPF
WLLNVVPKKRLRTNDPSYKHYVTKWFNVLMPKIDRFLYGNGGNIIMVQVENEYGSYNACD
QEYMLWLRDLYKRYVGYKALLYTTDGCGYSYFTCGAIPDVYATVDFGASVKDVSQCFKYM
RTTQKRGPLVNSEYYAGWLSHWREPSPVISSYEVVETMKDMLALNASINFYMFHGGTNFG
FTSGANKYESLKNPDYLPQLTSYDYNSPLDEAGDPTEKYFKIKKLLEGTNFIVSNEISPV
AAPKGDYGTFTMQPLVSLFEKVTQRIKPVESDVPLGFEIMGLNSGFVMYETILTDDQKDV
TAPVNLTISTIRDQATIFLDQAQIKVVPRKYENTPISLNINSTVQKLSILIENQGRINFG
SFLEDRKGIFEPVLLGRHVLGPWKMIAYPLNETSWFSTIEPQKDAVLPAFYKTQFKLPDG
LTKPLDTYLDVTGWKKGVAFVNGINIGRYWPSAGPQITLYVPATFLIPQPGLNTIVMLEL
EGVPENLSISLTDKPILFGPINVLQTNH
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgaaatagttttgagaacaagcaagccaacttttactgttgattacgaa
cgaaatgagttcctaaaagatggtcaagtttttcgatatgtctccggttcgttacattat
tttagagttcctaaaccttattggaaggacagaattcagaaaatgaaagcagctggttta
aatgccatatcaacttatgtggaatggagtttacatgaaccatatccaggagaatacaac
tttgatgatatagccgatttagagtatttcttgcagttagttaaagacgagggcatgtat
ttgttgctcagaccagggccatatatttgcgccgaaagagattttggtggatttccattt
tggttattgaacgtggtgcctaaaaaacgtctgagaactaatgatccaagttataaacat
tacgttaccaaatggtttaatgttcttatgcccaaaattgaccgctttttgtatgggaat
ggcggaaacataattatggttcaggtggagaatgaatatggtagctacaatgcctgcgac
caagagtatatgttgtggttgcgagatttgtataaacgttacgttggatataaagcttta
ctgtacacaactgatggatgtggatattcttattttacatgtggtgctatacctgacgtc
tacgcaactgtagattttggtgcctcggttaaagatgtttcccaatgttttaaatatatg
agaacaacacaaaagagagggcctctagtgaactccgagtattatgctggttggttatcg
cattggcgtgaaccatcgcctgtcatcagtagctacgaagttgtggaaactatgaaagac
atgctagctttgaatgcatcgatcaatttctatatgtttcatggaggtacaaattttggg
tttacttctggtgccaacaaatacgaaagtttaaaaaatccagattatttgcctcaatta
acctcatatgattacaattctccgctagacgaagcaggagatccaaccgaaaagtatttt
aaaattaagaaattactcgaaggaactaattttatagtgtcaaatgaaatatcacccgtt
gcagcacctaaaggtgattatggaacattcacaatgcagccattggttagtctttttgaa
aaagtcacgcaacggataaaaccggtagaaagcgatgttcctcttgggtttgaaatcatg
ggtttgaattccggatttgttatgtacgaaactattttgactgacgatcaaaaagacgtc
acagctcctgtaaatcttactattagcacaatcagagatcaagcaaccatctttttggac
caggcacaaataaaagttgtaccgcgtaaatacgaaaatacacctattagcttaaatata
aatagtactgttcaaaagctaagcattctaatagaaaatcaaggaagaatcaacttcgga
agctttttggaagaccgtaagggtatttttgaaccagtattattgggtagacatgtactg
ggaccgtggaagatgatagcgtaccctttaaatgaaacgtcttggttttcgacgattgaa
ccacaaaaagatgctgtattaccagcattttataaaacccaatttaaattacctgacggt
ttaacaaaacctttggatacttatttggacgttaccggttggaaaaagggcgttgctttt
gtgaatggaataaatatagggcgatattggccatcagctggaccacaaataactctttat
gttccagctacatttctaattccacagccgggtttaaacactatcgtcatgttggaactt
gaaggagttcctgagaacttgtcaatatcgttaactgataaacctattctttttggtcct
ataaatgttttgcaaaccaatcattaa

DBGET integrated database retrieval system