KEGG   Acyrthosiphon pisum (pea aphid): 100163269Help
Entry
100163269         CDS       T01076                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 889 aa AA seqDB search
MADNCCVSQNDNFICGVVEGFYGRPWTTEQRKDLFQKLKKWGVGCYVYAPKDDYKHRAYW
RDLYTVEEAEQLGGLISAARDCGVTLYYALSPGLDMTYSSQKEIATLKRKLDQVAQCGCK
AFALLFDDIEPDMSPADKEVFQSFAHAQVSITNEIFQHLGQPKFLVCPTQYCSARAVPNV
QNSDYLNTLGSKLAPQIDIMWTGQKVISRSLTTESIREITEVLRRPPVIWDNLHANDYDQ
KRVFLGPYQGRSPDLISQLRGVLTNPNCEYGANFVAIHTLAQWSKCTSDPPLITHDNESM
KLETESDEEGIIDLPENIYHSRRALRIAIKEWIPEFRRQKQAHGPIIKPQPTISIMSPVA
IPLASFNTCMATSTTTITTSTSTAPLSLSTTNNVESISSATVNGSPTNVLQTAVAVTLNP
PLVIMNSLVSESKVISEPMDCNMSPAPSPQSSDTAMNTDNGSSVSMQVETPSPSVDMVVD
VIQDQKHSYERDLTEEDLLLMCDLFYLPFEHGPQSVQYLTEFNWLKSNAYLVSNENLRKS
KKKDSTDSKPEIEEWYERAKRMDELTEQVNELFQRLTFSANRELVHDLYPYVWDVRCVIS
LLNFYVKWLSEGHFPQSITNYTLGSYTWFSKGWKESFMSGDQEPWVFRGGLVADLQRLMP
VDAGSDLFIYKPPDTPTNKMYNVRPYTFEDESAVYNICRCTCYTSIDDHSINKSDLPDLI
PDRLVGSYLTFSPELCFVVEDNGTVIGYALAALNAKEFYQKLQVSWFPEMCSKYPLDNST
EEIQSASQEIINWFHSFDINQELPDSNALSQHQSVMTYATLPVNNDASVSKRLIICLLAA
LRANGSFGVHVPLRTKDQQTLEFYTKMGFMEISQGSNLNPGFTYVGRVF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaactgctgcgtttcgcagaatgacaatttcatttgtggtgttgttgaagga
ttttatggaagaccatggactactgaacaacgtaaagacttgtttcaaaagttaaaaaaa
tggggagtagggtgttatgtgtatgcacccaaagatgattacaaacacagggcatattgg
agagatttgtatacagttgaagaagccgaacagttaggtggcttaataagtgccgctaga
gattgtggtgttactctctattatgccttgtctccaggacttgacatgacttatagtagc
caaaaagaaatagctactctcaaacgaaaattggatcaagtcgctcaatgtggttgtaaa
gcttttgccctattgtttgacgacatagaaccggatatgtcaccagctgataaagaagtg
tttcaatcgtttgcgcatgctcaggtgtcaattaccaatgaaatatttcagcatctgggt
caacctaaatttttagtgtgtccaactcaatattgctcagcacgtgctgtaccaaatgtt
caaaattctgattatttaaatactttgggctctaagttggcacctcaaatagacataatg
tggaccggacaaaaagttatatcacgttcattaactaccgaatctattagagaaatcact
gaagtattgaggcgacctcctgtaatatgggacaatttgcatgctaatgactatgaccaa
aagcgtgtcttcttagggccatatcaaggacgttctccggacttaatttcacaattaaga
ggagtattgactaatccaaactgtgaatatggtgctaactttgtagctattcatacattg
gctcaatggagtaaatgcacttctgatcctccattaatcacacatgacaatgaaagtatg
aaattagagactgagagtgatgaagaaggtatcattgatcttccagagaatatttaccat
tcgagaagagcattacgtatagcaataaaagaatggattccagaatttcgcagacagaaa
caagctcatggtcctattatcaaacctcaacctaccatatcgatcatgtctcctgtggca
attccccttgcatcatttaacacgtgtatggcgacttcaaccaccaccattacaacgtct
acatctactgcaccattatctttgtctacaactaataatgttgagtcaatttcatcagct
actgttaatggtagccctactaatgtcttacaaacggcagtagctgttaccttgaatcca
cccttagtgataatgaattctttggtgtccgaaagcaaagtcatcagcgagcctatggac
tgtaacatgtcaccggcgccatcaccgcagagttcagatacagccatgaacaccgataat
ggatcaagtgtttcaatgcaagtggaaacgcctagtccaagtgtggatatggttgtggat
gtgatacaagatcaaaaacattcatatgaaagagatctaacagaagaagatttattgcta
atgtgcgatttattttatttaccatttgaacatggtcctcaaagtgttcaatatttaaca
gaatttaattggcttaaaagcaatgcttatttggtttccaatgaaaatcttcgaaaatca
aagaaaaaagattcaactgactctaaacctgaaatcgaagaatggtatgaaagagcaaag
agaatggatgaattaacggaacaagttaatgagctattccaaagactgacgtttagtgcc
aatagagaactcgttcacgacctatatccttatgtttgggatgttaggtgtgttatatca
ttactaaacttctatgtaaaatggctttctgaaggccatttcccacaatcaatcacaaat
tatactcttgggtcttatacatggttttcaaaaggatggaaagaaagctttatgagtggt
gaccaagaaccctgggtttttagaggtggtttagttgctgatttacaacggttaatgcca
gttgatgctggttctgatttatttatatataaacctcccgatacacctacaaataaaatg
tacaatgtacgaccatatacttttgaagatgagtctgctgtatacaatatttgccggtgt
acatgttatacaagcattgatgaccatagtataaacaaatctgatttacctgacttaata
cctgatagacttgttggttcatatttaacatttagtccagaactttgttttgtcgtagaa
gacaatggcactgtcataggttatgcattagctgctttaaatgcaaaagaattttatcaa
aaattacaagtatcgtggtttcctgaaatgtgttcaaaatatccattggataattccact
gaagaaatacagtcagcttcgcaagaaatcataaattggtttcattcgttcgatattaat
caagaattgccagattccaatgctctgtctcaacatcaatcagttatgacctatgcaaca
ttacctgtgaacaatgatgcatcagtatccaaacgattaattatttgtcttctagcagca
ttaagagctaatgggtcattcggtgtccatgtacctttgagaacaaaagatcaacaaaca
ttggaattttatacaaaaatgggatttatggaaatttcgcaagggtctaatctaaatcct
ggctttacatacgtaggacgtgttttttga

DBGET integrated database retrieval system