KEGG   Acyrthosiphon pisum (pea aphid): 100163282Help
Entry
100163282         CDS       T01076                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:api00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 628 aa AA seqDB search
MDRTLWKNSITSYAGWFTNSLRRRRSILFGLILSILLFVVCVQYNASNDIGIQNIQNTLV
MSESDADEQPLNKHQPPAPISGTVRKMKKEEDVNFIEELQEPARKSRRIQINEPQQSLPY
VPPQRLVHIDFKGAPPKLSYLQKLFPLIKRFGGTGLLLEWEDMFPWSGSLSPIAAGNAYS
KAEIREILKMAALNGLEVIPLIQTFGHVEFALKLPDFAHLREVQESPQALCPSYNASMKF
VEQMVDQILEIHGNVNYLHIGCDEVFHMGECFRCRAKAREDLFLSHVKQVATYVRTKSPN
TIPIIWDDMLRHLPVATMQLYDIGKLVEPMVWVYAEDVYRFVMQSVWEKYQIVFPNAWTA
SAFKGAFGETLYIPNVKRHLENNLNWLQLMSNENSRFTGGFKGIVITGWQRYDHFAVLCE
VLPSSIPSMVVNLLATTNGYMNQSLQTDLNEGLNCGIFGHNNEYDGDFLNLNNDPHLWDQ
FSRCTFPGNTFFRLLYRLHTIEIDYNDFILVTTKNRGWMTSYNVEHEFSSPLRVDELMND
HSRIYRSLLSMVRPFQESMTGIFDKYTISEWIEQRVYPMIKELEKIHNEARDLKAKKTWP
KRPLPMLKELLRIGVTERELSTPSNEGT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggacagaactttatggaagaattcaataacttcatacgccgggtggtttactaactca
ttacgccgacgaagatccatattatttggacttatactcagcattcttctttttgtagta
tgtgtacaatacaacgcgtctaatgatataggtatccaaaacatccaaaacaccttagta
atgtctgagtctgatgctgatgaacaacccttgaataaacatcaaccaccagcgccaatt
tcgggtacggttagaaaaatgaaaaaagaagaagatgttaatttcattgaagaactgcag
gagccagcccgtaaaagtcgccggatacaaatcaatgaaccgcaacaatcactaccgtat
gtgcctccccaacgattagtgcatatcgatttcaaaggagcgccgcccaagctgagttac
cttcaaaaacttttccctttgataaaaagattcggtggtactggtcttttgctcgaatgg
gaggacatgtttccttggagtggaagtctatctccaatagctgccggaaacgcgtattca
aaagcagaaattagagaaatattaaaaatggccgcgttgaacggactggaagtaatcccg
ctaatacaaacgtttggtcacgtggagtttgcattgaaactaccggatttcgcccacctg
agagaagttcaagagtcaccacaagcactctgcccatcgtacaacgcttcgatgaagttt
gtcgaacaaatggtcgaccaaatcctcgagattcacggaaatgttaactacttgcatatt
ggctgtgacgaagtgttccacatgggagaatgtttcaggtgcagggcgaaagccagagaa
gatttgttcttgtcacatgtcaagcaagtagctacctatgtacgcacaaaatcccccaat
acgattcctattatatgggatgacatgctgagacatttaccggtagccacaatgcaacta
tacgacattgggaaattagtggagccgatggtgtgggtgtacgctgaggacgtgtataga
tttgtgatgcaaagtgtttgggaaaagtatcaaatagtattcccgaatgcgtggacagct
agcgctttcaaaggggcatttggagaaactctatacattccaaacgttaagagacattta
gaaaacaatttaaattggttacaattgatgtccaacgaaaatagtcggtttacgggtggt
ttcaaaggaatcgtcataactggttggcagagatatgatcattttgctgtcctatgcgag
gtcctaccgtcatccataccatcgatggtcgttaatcttttggcaactacaaatggctac
atgaaccagtcgctgcaaaccgatttgaacgaaggactcaactgtggtatttttggccac
aacaacgaatatgacggagatttcttaaacttaaataacgatcctcatctttgggatcag
ttttcgagatgcacatttcccgggaatacatttttcaggttgctgtatagattacacaca
attgaaatagactacaatgattttatattggtgaccacaaagaatcgtggatggatgact
agctacaacgtagaacatgaattttcatctccacttcgtgtcgacgaactcatgaatgat
cattcacgtatataccgatcacttttatcgatggttagaccttttcaggaatccatgact
gggatctttgataaatataccatatcagaatggatagaacaaagagtttatccaatgatt
aaagaactggaaaaaatacacaatgaagcacgtgacttaaaagcaaaaaagacatggcct
aaaagaccacttcctatgttgaaagaattattaaggattggagttactgaacgtgaactt
tctacaccatccaacgaaggaacgtaa

DBGET integrated database retrieval system