KEGG   Acyrthosiphon pisum (pea aphid): 100163322Help
Entry
100163322         CDS       T01076                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100163322
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100163322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 275 aa AA seqDB search
MKFVDISMDLHNHKSSAVQKLALTQIGLIFLLFSVIDSANYKKSSNYTFAKSSANMSINP
VVISSSVKQTATVIFLHGLGDSGNGWAEAMTQIRQPYMKVICPSASPMPVSLNQGFRMPS
WFDLFTLDESGPEDENGIKEAAKLVHSLIDREIETSNVPSSRIALGGFSQSGALALYSAF
TYNKPLAGVMALSCWIPLHKTFPAAALSNKDMPIIQCHGDCDPIVPLKWGQLTASILKSF
AKHTELKTYRGLMHSSSDMELKDLKKFLETVLPPV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtcgacatttctatggatttacataaccacaaaagttcggcagttcaaaaa
ctggcattaacccaaattggattgatttttttgttgttttccgtaattgattccgctaac
tataaaaaaagtagcaactatacttttgcaaagtcctccgcaaacatgtccatcaatccc
gtagtaatatcttcttccgttaaacagacggccactgtcatatttcttcatggtcttgga
gattcaggaaatggctgggctgaagccatgacacaaataagacaaccttatatgaaagtt
atatgtccatctgcgagtccgatgccagtatctctgaaccaaggtttccgtatgccttca
tggtttgatttgtttactttagatgaatctggtccagaagatgaaaatggaattaaagaa
gctgctaaattagtgcattcacttatcgatcgtgagattgaaacttccaatgtgccatca
tctcgtattgcccttggtgggttttcacaaagtggagctcttgctttgtactcagctttt
acatataacaaaccattagctggagttatggctctatcttgttggataccattacataaa
acttttccagcagctgctttaagtaacaaagatatgccaataattcaatgtcatggagat
tgtgatccaattgtaccactaaaatggggtcaacttacagcatccattcttaagtctttt
gctaaacataccgaactgaaaacataccgaggtttgatgcatagttcatctgatatggaa
ttaaaggatcttaagaaattcttggaaacggtcctccctccagtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system