KEGG   Acyrthosiphon pisum (pea aphid): 100163394Help
Entry
100163394         CDS       T01076                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100163394
Translation factors [BR:api03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100163394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 688 aa AA seqDB search
MAKKKDSEKHEDGQRGGKYNKDDADANELENFVDDITDEELLGDVLQKRPKVSDGVDTVI
IVDGVPQVNPERFDKLKVVITKIFAQFGKILNDYYPKSENGHTKGYIFIEYEKHESALEA
VTQANNYKLDKQHTFLINLFSDYKKYNDIPEKWEAPTLQPFPERPNLQYFLSEPDAFDQY
YVYNVNSHIEVWLNSNPQPTKLVEREKWTESLIMWSPLGTYLATLHKQGVVLWGGPNFTN
VLKLSHRNVQFVDFSPCEQYLVAYAPLDNDEQKLTIFDIRTGAEKRSFISDAPMAGNVLR
WSKDDKYFARIGHNTLSVYETPSFGLLDKKSITVNGIRDFSWSPRDNVLAYWVAEDKDVP
ARVVLLEIPSRKEIRANNLFNVADCKIHWQKAGDYLCVKVDRYAKIKREKGDVKYSGMYF
NFEIFHMREKNIPVDSVEIKEPIHAFAWEPIGSKFAIIHGEPSNNSVSFYNVKSGQAPVL
LKKLDKHFCSHLFWSPAGQYIVIAEIRDSGALEFVDTADFTTMCSTEHYKATDIEWDPTG
RFVATGVSSWKTKGDTGYWIWSFQGRILNRFNTNTYCHMQWRPRPPTLLSAKQQKDTKKS
LKKYTSQFETKDKMRMTKASKEVIDKRRKLIKEFEEYRSKRLEDWNKQKAERMAIRSHID
TDELDSDDKNVQVEKVEFLVKEEVTVID
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaaaaagattccgaaaagcacgaagacggccaaagaggaggaaagtacaat
aaggacgatgccgacgccaatgaattggaaaatttcgttgacgacattaccgacgaagag
ttgctcggcgatgtactgcagaagagacccaaagtgtccgatggcgtagacaccgtcatt
attgttgacggagttccccaagtcaaccccgaacgcttcgacaaactcaaggtagttatc
accaagatattcgcacagttcggtaaaattctcaacgattactatccaaaatctgagaat
ggtcacactaaaggttatatatttattgaatatgaaaaacacgaaagcgcattagaagct
gttacgcaagctaataattacaaactagacaaacaacatacttttttaatcaacttattt
tctgactacaagaaatataacgacattcctgaaaaatgggaagctcctactctacagcca
ttcccagaaaggcctaatctacaatatttcttaagtgaacctgatgcatttgatcaatat
tatgtttataatgtaaacagtcatattgaagtttggctgaatagcaatccacagccaaca
aaattagttgaacgtgaaaaatggactgaatctctaattatgtggtcacctcttggaaca
tacttagcaacactgcacaagcaaggtgttgtcctttggggaggaccaaatttcacaaat
gttttaaagctctctcatcgcaatgtacaatttgttgatttttctccttgtgaacaatat
ttggtggcttatgctccattagataatgatgaacaaaagttgacaatttttgatattcgc
actggggccgaaaagcgatcatttatttcagatgctccaatggctggtaatgtattaagg
tggtcaaaggatgacaaatattttgcccgaatcggccataatactctaagtgtttatgaa
actccatcttttggtttgttggacaagaaaagtataacggtcaacggtattcgagatttt
agttggtctcccagggacaatgtactcgcttattgggttgctgaagataaagatgtaccg
gctcgagtagttttattagaaataccaagccgcaaagaaattcgagctaacaatttgttt
aatgtagccgactgtaaaatccattggcaaaaagccggtgactatttatgtgttaaagtc
gaccgttatgctaaaatcaaacgtgagaagggagatgttaaatacagtggtatgtatttc
aattttgaaatatttcatatgagagagaaaaatatacccgtcgacagtgttgaaattaaa
gaaccgattcatgcatttgcttgggaaccaattggttcaaagtttgcaattattcacggt
gaacctagcaataatagtgtaagcttctataatgtcaaatctggccaagctccagtctta
ttaaaaaagttagacaaacatttctgcagtcatttgttttggtcacctgccggacaatat
atcgttattgctgaaatccgagattctggtgctttggaattcgttgacaccgcagacttc
accacaatgtgttctactgaacattataaagcaactgatattgaatgggatccaaccgga
agatttgttgctactggcgttagttcgtggaaaactaagggagatacaggctattggata
tggtcattccaaggaagaatattgaatagattcaatacaaatacctattgtcatatgcaa
tggagacctagacctcctactctgttgagtgctaaacaacaaaaggataccaagaaaagt
ttgaaaaaatacacttctcagtttgagacgaaagacaaaatgcgaatgaccaaagcctct
aaagaagtcattgataaacgtagaaaattgattaaagaattcgaagaataccgcagcaaa
cgtttagaggattggaataaacaaaaggctgaaagaatggctattagaagtcatattgat
actgatgaactagattcagatgataaaaacgtacaggtagaaaaggtcgaatttttggtt
aaagaagaagtaactgtaattgattaa

DBGET integrated database retrieval system