KEGG   Acyrthosiphon pisum (pea aphid): 100163418Help
Entry
100163418         CDS       T01076                                 

Definition
cAMP-dependent protein kinase catalytic subunit beta-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100163418
   04340 Hedgehog signaling pathway
    100163418
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100163418
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100163418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 374 aa AA seqDB search
MYGGESTPEAEPQTIISVENEIITHDNNCTLEDINKVNEYLECSKIKFENRLRQQQIKES
SIDDFIIHKTIGMGAFGRVLLVNYKLKPEKFLAMKIMKKEQILKRNFLQHVFNEKQLSSN
LRHPFIIHMEYYAKDICNLYFIMPFIVGGDLFGLMSERGVLDELHAMFYAGQMILALEYL
HSLDIIYRDLKPENVLIAADGFIKLTDLGLSKRITSNRTTTLCGTPYYLAPEIIAIKPYG
KPVDWWALGIIIFEMVSGSVPFIADTEKKLFYKILSGSYRMPINFSPNLSHFVKNLLQVD
LSKRYGNLQNGISDIKSHRWFNKIDWIILYNKNMVPQYIPTFNSPSDTHNFESFVEEDTS
IICNGVDQTHFANF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtacggtggcgaaagtaccccagaggctgaaccacaaaccataataagtgttgaaaac
gaaatcataactcatgacaataactgtacattagaagatataaataaagttaatgaatat
ttggaatgttcaaagataaagtttgaaaatcgattaagacaacaacaaattaaggagtct
tcaattgatgattttataatccataagaccattggaatgggtgcttttggacgtgttttg
ttagtcaattacaaattgaaaccagaaaaatttttagctatgaaaattatgaagaaagag
caaatcttaaaaagaaattttttacaacacgtattcaatgagaaacaactatcatcaaac
ttacgacatccgttcattatacacatggagtattatgcaaaggacatatgcaacttatat
ttcattatgccgttcatagtaggcggagacttattcggtttaatgagtgaacgaggtgta
ctagacgaattgcatgctatgttttatgcgggtcaaatgatcctagcacttgaatattta
cattcgctggatataatctatagagatttgaaacctgaaaatgtgttgattgccgctgac
ggttttataaaattaacagatctcggattgagcaagcgaattacttcaaatcgaacgacc
acactttgtggtactccgtactatttggcaccggaaatcatagcaatcaaaccgtacgga
aaacctgtggactggtgggcattaggcataatcatatttgaaatggtttctgggtcagtg
ccattcattgctgacactgaaaaaaaactgttctataaaatcttgagtggtagttacaga
atgccaatcaatttttccccaaacctttcacattttgttaaaaacttactacaagttgac
ctatcaaaaagatatggaaacttacaaaatggaatttctgacatcaaatctcaccgatgg
tttaacaaaatagattggataatactctacaacaagaatatggtaccacaatacatacca
acttttaatagtccatcagatacacataatttcgaatcatttgtcgaagaagacacctct
attatatgtaatggagttgaccaaactcatttcgccaatttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system