KEGG   Acyrthosiphon pisum (pea aphid): 100163474Help
Entry
100163474         CDS       T01076                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100163474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 228 aa AA seqDB search
MAWRSHGRNNIELVQNLRANNVIKSDKVEKIMKVVDRGNYVSTSPYLDQPQSIGYGVTIS
APHMHAYALELLKDQLVEGERALDIGSGSGYLTACMATMLGENGKAVGIDHIPELVEKSL
ENVKKDNPELLNSQRVILETGDGRLGLEKYAPYNAIHVGAAAEKIPQPLIDQLKPGGRLV
LPIGPQNGDQVLEVIDKKLDGSISRKKLMDVIYVPLTDAASQRSKRNH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagatctcatggtcgaaataatattgaacttgtacaaaacttacgtgctaac
aatgttattaaaagtgataaagtagaaaaaataatgaaagtcgttgataggggcaattat
gtatcaacatcaccatatttagatcaaccacaaagtattggctatggagttacaatcagt
gcacctcatatgcatgcatacgctttggaacttttgaaagatcaattagttgaaggggaa
cgagccttagatattggttctggatctggatatttaactgcttgtatggctacaatgtta
ggagaaaatggaaaagctgttggcattgatcatattcctgaacttgttgaaaaatcttta
gaaaatgttaaaaaagataatccagaactattaaattcccagagagtgattttagaaact
ggagatggacgactaggattggaaaaatatgcgccatataatgcaattcatgttggagct
gctgctgaaaaaattccacaaccgttaatcgatcaattaaaaccgggtgggcgtcttgta
ttaccaattgggccacaaaatggagatcaagtgttggaagtgattgataagaaattagat
ggctcaatatccaggaaaaagctgatggatgtgatctacgtacctctaacagatgcagca
tctcaaagaagtaaacggaatcactga

DBGET integrated database retrieval system