KEGG   Acyrthosiphon pisum (pea aphid): 100163481Help
Entry
100163481         CDS       T01076                                 

Definition
serine/threonine-protein kinase mTOR
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100163481
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100163481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 2486 aa AA seqDB search
MSSVRMQYFVTRLKSKNLEIRKRAARDLNLYVKTELREVSAEERAVFNDEFNQHIYEMVS
SSDSNEKIGGILAILCLIGADVGNKNNRISRFANYLRNLLPSADSAVMELAAKTVGKLAL
DSGTYADQYVEFEVKRAFEWLGGVRNEPKRYAAVLILREIATMVPTLFFQHAAQFFDLVL
NVARDPKPNIRDGAVEALRAALVVTAQRETSKQTQKSEWYKQCYEEVMNGIDDSINKEKG
IVRDDKIHGSLLVLNELLRVSNVNWERRNDSLMQRLQWDQSQTSAEILSLLPRTKSALKG
LVGGSGRTDDDSVRIASSGIRYESSACKNLLQENYDRVCSSAISHRMCRNLLVNSALMKL
LPRLAAFNKSIFVQNYLNSSMLFLLATIRGRDRDQRTYAFVAVGLVAIAIEDHIKPYLSK
IVELIRSFLPSKDSSKKKPINSEPAVYVCITLLGIATQHNIKNDLKELLEPMLAMGLSPT
LTIAFKELAVAVPALKKDISDGLLKILSQVLNNRNTSIALPLSVTSSALSLSLMPSAFES
QNISNIVLALRTLGSFNFEGHSLLQFLRRCAEHYLGSEQQEVRIESVRTCSRLLRLAIES
PQSKTSHTVRYTISTVIKQLLVVGVADTDPDVRYVVFENLDRSFDFYLAQVHNLTALFMA
MNDVNFEIREMALCTIGRLSLVNPAYVMPPLRKTLMQCLTELEHSGMGRNKEQSARMIDH
MAVHAPRLVAPYVQPVLKILVPKLHEPDLNPSILISILACIGDLAQVNGEEMCCWTDELL
PFLLDMLGDGASQEKRGVALWVLGKLVEGLGYVIQPYEKYPSLLDTLLGFLKTEQQPIVR
RETIRVLGLLGALDPYKHKMNLGQIDSQIESTALLSMTDPRPISETEWTTSEMLVNMSTS
TLEEYYPAVAVATLIRIIRDPNLFQHHTMVVQAITFIFQSLGIKCVAYIPQVMPSFLNVI
RTADANFREYLFQQLGVLINIVGPHIRNYLDDIFLLIKELWIPNSSLQCTLIQLVEYIVV
ALGAQFKTYLSQLMPNILRILYHDSSKNRNVTKRMVVALCKFGINLDEYLHMIMPPLVNL
FDATDHPTQVSQVAMETVAQLAYTLDFTDYASRIIHGIVNSIESTPELRKTAMETLCALI
CQLGRKYMIFMPLVARTLNKCQYNYPPYDMLITYISSNTDGSLEENLLLSRHKQFKSKKE
VGVHLVGDAATIIKKMHTSLPNLQKAWLANRCVSKDDWLEWLRRLGIDFLKESPSPALRS
CWALAQTYSQLPKDLFNAAFVSCWTELTEPLRKELIQTLEQALMVSDLPEMTQTILNLAE
FMDHCEKGPLPIDPHILGERAMDCRAYAKALHYKEDEYIQEINSQVCPNIIESLISINNK
LQQKEAASGLLEVVMSKQEEDQEPGEQLKIQARWFEKLHNWEQALSCYEGFLQKEPNDIE
WSLGEMRCLESLGQWGKLNNVAASHWLHFPESGREKMSRVAAASAWGLKQWQKMAVYVDF
IPRDTMDGAFYRAVLSIHGEQYEHAQKFIDLAREILDTELTAAAAESYQRAYGAMVSVQM
LSELEEVIQYKLKPEKRPIIYKVWWDRLQGCQRVVEDWQRIIQVHSLVLNPEEDMHTWLK
YAALCRKSSRLVLSHKTLTTLLGIDPSKNPSEPLPMTHPQVTFAYIKHMWTSGTKAEAFN
HLNSLIQYVLPQLKRKGKDSEKHRSDPTKKLLARCYLKLGNWQEELQGLTELSIPNVLEH
YKEATVHDVSWYKAWHSWAYMNFETVLFYKHKQNKSQSNDHTAEKVITDKASSEFPKSDQ
YISNFTVPAVEGFFKSIALSQGSSLQDTLRLLTLWFEYGQDHNVYEAIVDGLKSSHINTW
LQVIPQLIARIDTPRTLVSRLIQVQLIDIGKHHPQALVYPLTVANKSASAARRNAARKIL
KTMCEHNPILVQQAVMVSDELLRVAILWHELWHEALEEASRLYFGENNVKGMYEVLEPLH
AMLEKGPETLKETSFNQTYGRDLVEALEWCNRYLVSGNNRDLNQAWDLYYHVFRRITRQL
PQLTNLELQYVSPQLHQSRNMELAVPGSYIPGQPIVRIAYIQSSLSVITSKQRPRKLVIK
GSDGNEFMFLLKGHEDLRQDERVMQLFGLVNTLLLNDPDTFRRNLTIQRYAVIPLSTNSG
LIGWVPHCDTLHTLIRDFREKKKTLLNIEHRIMLRMAPNYDHLTLMQKVEVFEHALTNSN
GDDLARLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILH
IDFGDCFEVAMTREKFPEKIPFRLTRMLINAMEITGIEGTYRRTCESVMTVLRNNKDSLM
AVLEAFVYDPLLNWRLMEAGVCARRTAAATAGATVVGTNPISAASAATTVSEETNMATSF
AASLSKKAAPMNVGPGGDIGNIETEPTEALNMKALAIVTRVREKLTGKDFIHEQELTVPR
QVNLLIQQATANENLCQCYIGWCPFW
NT seq 7461 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgtacgcatgcaatattttgtaaccaggttaaagtccaaaaacttagaaatc
cgtaaacgtgctgctcgagatttaaatctctatgttaaaactgaactacgtgaagtatca
gcagaagagcgtgcagtttttaatgacgaatttaaccaacatatatatgaaatggtgtca
agttctgacagcaatgagaaaattggtggaatacttgctatattgtgtttaattggtgct
gatgttggcaataaaaataaccgtattagtaggttcgcaaactatctacgtaatttattg
ccatctgccgattcagcagtaatggagcttgctgccaaaacagttggaaaattagccttg
gattctggcacttatgcagatcagtatgttgaatttgaggtgaaaagagcatttgaatgg
ttaggtggtgtaagaaatgagcccaaaagatatgctgcagtgctcatactcagagaaatc
gctactatggtacccactctgttttttcaacacgcagctcaattttttgatttggtgcta
aatgtagcgcgtgatccaaaaccaaacattagagatggggctgtagaagcattaagagca
gctcttgttgtaactgctcaaagagaaacctctaaacagacacagaaatctgaatggtac
aagcaatgttacgaagaagttatgaatggaatagatgattctattaataaagaaaaagga
attgttcgtgatgataaaatacatggatcattattagtgttgaacgaattgctgagagtc
agcaatgtgaattgggaaagacgaaatgactctttgatgcaaagattgcagtgggatcaa
agtcagactagtgcggaaatactgagtttattacctcggacaaagtctgctttaaaagga
ctcgtgggtggttctggacgaacagatgatgactcagtaagaatcgcatcatcaggtatt
cgatacgaaagtagtgcttgtaaaaatctactgcaagaaaactatgatcgagtgtgttca
tcagcaatatctcatagaatgtgcagaaatcttttagtgaattctgctctgatgaaattg
cttcctagattagctgcgttcaataaatcaatttttgttcaaaactacttaaattcttca
atgctgtttcttcttgcaactattcgtggtcgtgatcgtgatcaacggacttatgcattt
gttgctgttggtctagtagcaatagctattgaagatcatattaaaccgtatttatccaaa
attgtagaattgatacgtagtttcttaccatccaaggatagctcaaaaaaaaaacctata
aattctgaaccagcggtgtatgtttgtattacattattgggaatcgctactcaacacaat
attaagaatgatcttaaagaacttcttgaacctatgttggccatgggcctcagtcctact
cttactatagcttttaaagaattagcagtagctgtacctgcattaaaaaaagatatatct
gatggattactgaaaatactgtctcaagtgcttaacaaccgtaatacttcaatagctttg
ccattatctgttacaagttctgcgctcagtttgtcattgatgccatcagctttcgagtct
caaaatatttcaaatattgttttggctctcagaacacttggtagcttcaactttgaaggg
cattctttactgcaatttttacgtcgctgtgctgagcattatcttggaagtgaacaacag
gaagtccgaattgaatctgttcgaacatgtagccgtttattacgtttggcaattgagtcg
ccacaaagtaaaacatctcatactgttagatacacaatttctacagtaatcaagcaacta
ctggtcgttggagttgctgatactgatcctgatgtgcgttatgtagtgtttgagaatctc
gaccgtagttttgatttttatctagctcaagttcacaatcttaccgcattatttatggct
atgaatgatgtaaattttgaaataagagaaatggccctctgtactataggacggcttagc
ctggtaaatcctgcttatgtaatgccaccattacgcaaaacactgatgcagtgcttgact
gaacttgaacatagtggaatgggtcgtaataaagaacaaagtgccagaatgattgaccac
atggctgttcacgctcctcgtcttgtggctccatatgtgcaaccagttttaaaaatattg
gttcctaaacttcatgaaccggatttaaatccgagtattttgataagtatacttgcatgc
attggagatttggcacaggtaaatggagaagaaatgtgttgttggactgatgaactgttg
cctttcttattggacatgttaggcgatggtgcatcccaagaaaaacgtggagttgctctg
tgggtacttggtaaattagttgaaggacttgggtacgtcattcaaccatatgaaaaatac
ccttcattattggacactttactgggatttttaaaaaccgaacaacaacctatagtcaga
agagaaacaatacgggtactaggactccttggagctttagatccttataaacataaaatg
aacttgggacagattgattctcaaatcgagtctactgctttactctcgatgactgatcct
cgtcctatatcagaaaccgaatggacgactagtgaaatgttagtaaacatgagtacatca
acattggaagaatattatccggccgtagcggttgcaacacttatacgcataattcgtgat
ccaaatttatttcaacatcacactatggttgtacaagctataacatttatttttcaatct
ttgggtataaagtgtgtggcatacataccacaagttatgcccagttttttaaatgtaatt
cgtacagcagatgccaacttcagagaatatctattccagcagttgggtgtacttataaat
attgttgggccacacatccgcaactatttggatgatatatttttattaattaaagaatta
tggatcccgaatagttcactacaatgtactttaatccaactagtcgagtacatagtcgtg
gcgcttggagcacaatttaaaacctacttatctcaattaatgcctaatatactaagaata
ctttatcatgactctagtaaaaaccgcaatgttactaaaaggatggttgtagctttatgt
aaatttggtattaatttggatgaatatttacacatgattatgccaccactagtaaactta
ttcgatgctactgatcatcctactcaagtcagccaggtggcaatggaaactgttgcacaa
ttagcatacaccttggattttaccgactatgcatcacgcataatacatggaattgtaaat
tctatagaaagtacaccagaacttagaaaaactgccatggaaacattatgtgcattgata
tgtcaattgggtcgcaaatatatgatttttatgccacttgttgctcgtactttaaataaa
tgtcaatacaattatcccccttatgacatgctcattacttatatatcatcaaacactgat
ggaagtctagaagaaaacctgttgctttctagacacaagcagtttaaaagtaaaaaagaa
gttggtgtacatttagttggagatgcggctaccataataaagaagatgcatacgtcattg
ccgaatttacaaaaagcctggttggcgaatcgttgtgtatctaaagatgattggctagag
tggttaagacgactaggcattgatttcttgaaagaatcaccatcaccagcactgcgttca
tgttgggcacttgcccaaacatattctcagttgcccaaagatctgttcaatgcagcgttt
gtcagttgttggacagaattaacagaaccacttcgaaaagagctaatacagactttagaa
caggcattgatggtttctgatcttcctgaaatgacacagactatattgaacttggcagaa
tttatggatcactgtgaaaaaggaccattgccaattgaccctcatatacttggtgaaaga
gctatggactgcagagcttacgcaaaagctctgcactacaaagaagatgagtacatccaa
gagataaatagtcaagtatgcccaaatattattgaatcacttatatccattaacaacaaa
ttacagcaaaaagaggccgcatcgggtctgttggaagtagttatgagtaagcaagaagaa
gaccaagaacctggtgaacagttgaaaatacaagcaaggtggttcgaaaaactacataac
tgggaacaagcattgtcatgttacgaagggtttttgcaaaaggaaccaaatgatatagaa
tggtcattaggagaaatgagatgtttggaatctttgggtcaatggggaaagctgaataat
gtggctgcttctcattggttacattttcccgaaagtgggcgtgaaaaaatgtcaagggtt
gctgcagcttcagcctggggactaaaacagtggcaaaaaatggcagtttatgtggatttc
ataccgagagacactatggatggggccttttatagagcagttttatctattcatggagaa
cagtatgaacatgctcagaaatttattgatttggctcgggaaattttggataccgaactt
acagcagccgcagcagaaagttaccaaagagcttatggtgccatggtttctgtacaaatg
ttatctgaacttgaagaagttattcaatataaacttaaaccagagaaacgtccgattatt
tacaaagtttggtgggacaggcttcagggatgtcaaagagttgtagaagattggcagcgt
ataattcaagtacattcattggtgttaaatcccgaagaagatatgcatacatggcttaag
tatgctgctttgtgtcgcaaatcatcacgcttggtattgtctcataagactctcacaaca
ttattgggtatagatccttcaaaaaatccttctgaaccattaccaatgacacatcctcaa
gtcacatttgcatacattaagcatatgtggacttctgggactaaagcggaagccttcaat
catttgaatagtttgatccaatacgtgctgccacaattaaaacgaaaagggaaagatagt
gagaaacatagaagtgatcctactaaaaaattattggccagatgctatttaaagctaggt
aattggcaagaagagcttcagggtttgactgaattgtcaataccaaatgttttagaacac
tacaaagaggcaacagttcatgatgttagctggtataaagcatggcattcgtgggcgtat
atgaattttgaaacggttcttttctacaaacataaacaaaataagtcacagtcaaatgat
catactgcagaaaaagtaataactgataaagctagctctgagtttccaaagtctgatcaa
tatatttcgaattttactgtacctgcagttgaaggattttttaaatctatcgcactgtct
cagggtagttcactacaagatacattgaggctcttaactctttggtttgaatatggtcaa
gatcataatgtgtatgaagccattgttgatggcttgaaatctagtcatatcaatacatgg
ttacaagtgatacctcaactgattgctcgcattgacacgcctcgtacactagtcagtcgt
ctgattcaagttcagctaatcgatataggcaaacaccatcctcaggctttggtttatcca
ctgactgttgcaaataaatctgccagtgcagcacgtaggaatgctgcaagaaaaatctta
aaaacaatgtgtgaacataatccaattttagtgcagcaagcagtcatggttagtgatgaa
ctacttagggtagccatactttggcatgaattgtggcatgaggccttggaagaagccagt
aggttgtattttggtgaaaataatgtaaaaggcatgtatgaagtgttagaaccattgcat
gctatgttggaaaaaggaccagagactctgaaagaaacatcatttaaccaaacatatggt
agagatttggttgaagctttagaatggtgtaatcgttatctggtttctggcaataatcgt
gatttgaatcaagcatgggatttatattatcatgttttccgtcgaataactaggcaattg
ccccaacttacaaatttagaacttcagtatgtcagcccacaattacatcaaagtcgtaat
atggaacttgcagttccaggttcatacatacctggtcaacctattgtcaggattgcttac
attcaaagctcattgagtgtaatcacttctaaacaacgtcctcgcaagttagttattaaa
ggtagtgacggaaatgaatttatgttcttgttgaaaggccatgaagatcttagacaagat
gaaagagtaatgcaactttttggcttggtcaatacactattgcttaatgaccctgacacg
ttcagaaggaatttaactattcagagatatgccgtgatacctttatcaactaactcaggt
ctcattggttgggtacctcattgtgacactttgcatactctaatacgtgatttcagagaa
aagaagaagacattattgaatatagaacacagaatcatgttaagaatggcaccaaactac
gatcatttaacattaatgcaaaaggttgaagtatttgaacacgctttgactaatagcaat
ggagatgatctagcaaggttactgtggctcaagtctccatcatctgaagtttggtttgat
cgtagaacaaattacacaagatcattggctgtgatgtctatggttggctatatactcgga
ttaggagacaggcatccttcaaatttgatgttggaccgtttaagtggaaaaatattacat
atagattttggtgattgttttgaagtggccatgacacgtgaaaagtttccagaaaaaatt
cctttcagacttactagaatgcttattaacgctatggaaatcactggtattgagggaact
taccgtagaacctgtgaaagtgtcatgactgtgcttcgaaacaacaaagacagcttaatg
gctgttcttgaggcttttgtgtatgacccgttgctaaattggcgtctaatggaggctggt
gtctgtgctcggagaacagcagctgcaactgctggtgctacagttgtcgggacaaatcct
ataagtgcagcctctgcggctactacagtttcggaagaaacgaacatggctactagtttt
gcagcttctcttagtaaaaaagctgctcctatgaatgttggtccgggaggtgatattggt
aacattgagactgagccaactgaagcattgaacatgaaagctctagctatcgtcacaaga
gttcgtgaaaaattgactggtaaagattttattcatgaacaagaactaactgtccccaga
caagtaaatttactcatacaacaggccactgccaacgaaaacctttgtcaatgctacatt
ggttggtgtccgttttggtga

DBGET integrated database retrieval system