KEGG   Acyrthosiphon pisum (pea aphid): 100163558Help
Entry
100163558         CDS       T01076                                 

Gene name
Cych
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100163558 (Cych)
  Replication and repair
   03420 Nucleotide excision repair
    100163558 (Cych)
Transcription machinery [BR:api03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100163558 (Cych)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 300 aa AA seqDB search
MFPTSTQKTNWIFKDELDLNALREDANQKFITRFGSHMSPEDRNTFFLDANEEHIIQKCH
EYILRDFCHKFQPTMPKYVFATALNYLKRFYLYNSVMDYHPKEIMVTCLFLACKVDEFNV
SLAQFVANIKGNQSRATTVILNNELFLMEQIKYNLKVHHPFKAIEGFLLDIKTRTRMSDP
DRMRTHIDSFIDKLLFTDACLLFAPSQLALAAVLHSASQIKENLDSYVTDLLLGDTGSEH
LKDLIEVVRRIRILHVRIADDHTKELSRISKKLDKCRNQENNPFSEKYKDRIQESLNNSL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaacgagcacgcaaaaaacgaattggatattcaaagacgagttggatttgaat
gcattgcgagaggatgccaaccagaagttcattaccagattcgggtcgcacatgagtccc
gaagaccgaaatacattttttttagatgccaacgaagagcatataatacagaaatgtcac
gagtatatattaagagatttctgtcacaagtttcagccaaccatgccaaagtacgtattc
gcaactgctttaaactatctgaaacgattttacctgtacaattcggtcatggattaccat
cccaaagaaataatggtcacctgtctgtttttggcgtgcaaagttgatgagttcaatgta
tcgctcgcacaatttgtcgccaacattaagggcaaccaatcaagagcaaccacagtgata
ctgaataatgagttgtttcttatggaacagatcaagtacaacctcaaagtgcaccatcca
ttcaaggcaatcgaaggattccttctagacataaagactagaacacgaatgtccgatcca
gaccgtatgcgtactcacattgatagtttcattgacaagctattgtttacagacgcatgt
ttattatttgcaccatctcagctggcactagctgctgtattacattcggctagtcagatc
aaagaaaatttggattcatatgtaaccgacttactgttaggtgatacggggtctgagcat
ttaaaagatttgatagaggttgtacggagaataagaatattgcacgtcagaatagcagat
gatcatacaaaagaactgtcacgtattagcaaaaaattagataaatgtcggaaccaagag
aacaatccattcagtgaaaaatataaagatagaatacaagaatcattaaataattcttta
tag

DBGET integrated database retrieval system