KEGG   Acyrthosiphon pisum (pea aphid): 100163656Help
Entry
100163656         CDS       T01076                                 

Definition
lysosomal thioesterase PPT2 homolog
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100163656
  Lipid metabolism
   00062 Fatty acid elongation
    100163656
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100163656
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100163656
Lipid biosynthesis proteins [BR:api01004]
 Fatty acid synthase
  Component type
   100163656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 392 aa AA seqDB search
MTMEKSDECNNTSGQKPPYRPVVIVHGLMTGDVSTMQHLAARIAELHPGTKTYVIDRFCG
LASLEPLWRQTRKLADDLLKICSLHPEGVHIIGYSQGGLIARGMIEEYGTEHNVRTFVSL
SSPQGGQYGAECFTKMFPALTARTAYELFYTRLGQRALSVANFWYDPRHRDLYLKYSVYL
AVIDNVKQESSCLHLQQNENDNGLKTMMGNMSTAVTSSTTTVAETNDDTQKNIEARVAAA
IAAVSAATVKISESHNDNNSDARSVTTDVDTLMAMVSAHDNYCAENDNYNSNPNIKKLGL
TRLQRLVLIGGPDDGVISPWQSSQFAVLDSSGGLIPMRERRQDDVYSDNDPIGLHQLDMT
DRLVEYTVPGVNHHEWHHNEKVLRECIIGWLD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggagaagtctgatgaatgtaacaatacgtcagggcaaaagccaccgtacagg
ccggtagtcattgtacatgggctaatgactggtgatgtcagcacaatgcagcatctggct
gctcgtatagctgaattacatccaggcaccaaaacatatgttatagacaggttctgtgga
ttggctagtttagaaccactgtggcgacagacaaggaagttagctgatgacctattaaaa
atatgttcgttgcatccagagggtgtgcatatcataggatactcacaaggtggactcata
gcaagaggcatgatagaagagtatggtactgagcacaatgtcaggacatttgtatcactt
agctcaccgcaaggaggccagtatggtgctgagtgtttcacaaaaatgtttcctgcattg
acagcacgcacggcatatgagttgttctacacacgcttaggtcaacgggcattgtctgtg
gcaaacttctggtatgatcccaggcatagggacctataccttaaatacagtgtgtatctt
gcagtcatcgataatgttaaacaagaatcgagttgtcttcatttacaacagaatgaaaat
gataatggtttaaaaacgatgatgggcaatatgtctactgcagtaactagtagcactaca
actgtagcagagaccaatgatgacactcaaaaaaatattgaagcacgtgttgctgcagca
atagcagcagtttccgctgccactgtcaaaatttctgaaagccataacgacaacaacagt
gatgctcgcagtgtaacaacagatgtagatacacttatggctatggtctcagcccacgat
aactactgtgcagaaaatgataactataattctaaccccaacatcaagaaacttggcctg
actcgactgcagcggctggtattgattggtgggcctgacgatggggttatttcaccttgg
caatccagtcaatttgccgtactggatagttctggtggactgataccaatgcgggaacgg
cgacaagacgacgtgtacagcgataacgacccaattggattacatcagctagacatgacg
gatcgattggtggagtacactgtgccgggagtcaatcatcatgagtggcaccataatgaa
aaggtactacgtgagtgcataattggatggttagactag

  All links  
No link information was found.   
DBGET integrated database retrieval system