KEGG   Acyrthosiphon pisum (pea aphid): 100163785Help
Entry
100163785         CDS       T01076                                 

Gene name
Accoas
Definition
acetyl coenzyme A synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:api01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:api00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:api00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:api00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 678 aa AA seqDB search
MSKNVYLPYSATSEKAHVKSMEHYREMHNKSLESTAQFWSEIASQFHWETPYDINNFYSY
NFDVTKGPVQVKWMEGATTNVCYNLLDKNVRNGMGDKVAFYWEGNDPEDYSKITYKKLLE
EVCRFSNVLKSKGVVKGDRVAIYMPMIFEIVITMLSCARIGAVHSIVFAGFSSDSLAERM
ADCKCKVLVTADSVYRGDKLLNIKSLCDIAMDKAKNFGHEVSTCIVVRHLPRLYRSMNTS
NGTNGSNSDIIDLHSDVPWTDGRDYWWHDEMDDVEPSCYPVWVSAEDPLFMLYTSGSTGK
PKGVLHTTGGYLLYAATTFKYVFDYHPGDVYWCTADIGWITGHSYVVYGPLANGATSVIF
EGTPFYPDNGRYWSVIEKYKVTQFYTAPTAIRALMKFGEEPVKKHNLDSLKVLGSVGEPI
NPEAWLWYYQHIGKERCSIADTFWQTETGGHVITPLPGCTPMKPGSASFPFFGVKPILLD
ESGKEIEGVGEGYLVFNKPWPGIMRTLFGNHERFQSVYFSKFPGYYCTGDGARRDEDGYF
WVTGRVDDMLNVSGHLMSTAEVESVLTEHPDVSEAAVVSRPHPIKGECLYCFITPNHGVT
FTPQLSSELVKKVRESIGPFAMPDVIQHAPGLPKTRSGKIMRRVLRKVAINDREVGDIST
LADEHIVEELFKNRPEKS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaacgtatacctcccgtatagcgcgacatccgagaaggctcacgtcaagtct
atggaacattaccgggaaatgcacaataaatcattggagtcgaccgcgcaattttggtcc
gaaatcgcgtcacaatttcactgggaaacgccgtacgacatcaacaacttttactcatac
aacttcgacgtgaccaaagggcccgttcaagtcaaatggatggaaggtgccactacaaac
gtgtgctacaacctactggacaagaacgtgcgcaatgggatgggtgacaaagtagctttt
tactgggaaggcaatgatccggaagactatagcaaaatcacatataaaaaacttttagag
gaagtttgccggttttcaaatgtattgaaatctaaaggcgtagttaaaggtgaccgtgtc
gcaatttatatgccaatgatttttgagatcgtgattactatgttatcgtgtgcaagaatc
ggcgcagttcactctattgttttcgcaggattttcatccgattcgctagcagagcgtatg
gccgactgtaagtgcaaggtccttgtgacagctgatagcgtatacagaggagacaaattg
ttaaacattaaaagcctatgtgatattgcgatggacaaagccaagaattttggccacgaa
gtttcaacttgtattgtagttcgtcacttaccgcgtctttacagatccatgaacacatct
aatggtacaaacgggtctaactccgacatcatagatctacattcagacgtgccatggact
gatggacgagattattggtggcatgatgagatggatgatgtagaaccctcttgttatcca
gtctgggtgtctgcagaagatccactatttatgttatacacgagtggatcaacaggaaaa
ccaaaaggagtacttcatacaactggtggatacttattatacgctgctactactttcaag
tatgtttttgattaccacccaggggatgtttattggtgcacagcagatattggttggatc
actggccactcttacgttgtttatggacctttagcaaatggggcaacttcagttatattt
gaaggaacaccattttatccagataatggaagatactggtcagttattgaaaaatacaaa
gttacacagttttacactgcaccgacagccattcgtgcacttatgaagtttggagaagaa
ccagtgaagaaacataatctcgattcactaaaagtattgggttcagtaggtgaaccaata
aacccagaagcttggttgtggtattaccaacatattggtaaagaaagatgttccatagca
gacacattttggcaaactgaaaccggagggcatgttataactccactaccgggttgtaca
ccaatgaaaccaggatcggcatcatttccgttctttggtgttaaaccaatcctattggat
gaaagtggtaaagaaattgaaggagttggagagggatacttagttttcaataagccttgg
cccggtataatgcgcacattatttggaaatcatgaacggttccaatcagtttacttcagc
aaatttccaggatactattgtacaggagatggtgcaagaagagatgaagatggatacttt
tgggtgactggaagagtggatgatatgttaaatgtatctgggcatttgatgagcactgct
gaagtggaatctgtactcacagaacacccagatgtttctgaagctgcagttgtatcaaga
ccacatccaatcaaaggagagtgtctttattgttttattactcctaatcatggtgtgact
tttacaccacaactttcatccgagttggttaaaaaagtgagggaatcgattgggcctttt
gctatgccggacgttattcaacatgcaccaggtcttccaaaaactcggtctggaaaaata
atgagaagagtcttacgaaaagtagcaatcaatgacagagaagtaggtgacatatcaaca
ttagctgacgaacatatagttgaagaactattcaaaaatcgaccggagaaatcataa

DBGET integrated database retrieval system