KEGG   Acyrthosiphon pisum (pea aphid): 100163785Help
Entry
100163785         CDS       T01076                                 

Gene name
Accoas
Definition
(RefSeq) acetyl coenzyme A synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00010  Glycolysis / Gluconeogenesis
api00620  Pyruvate metabolism
api00640  Propanoate metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100163785 (Accoas)
   00620 Pyruvate metabolism
    100163785 (Accoas)
   00640 Propanoate metabolism
    100163785 (Accoas)
Enzymes [BR:api01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100163785 (Accoas)
Lipid biosynthesis proteins [BR:api01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100163785 (Accoas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 100163785
NCBI-ProteinID: NP_001153823
Position
Un
AA seq 678 aa AA seqDB search
MSKNVYLPYSATSEKAHVKSMEHYREMHNKSLESTAQFWSEIASQFHWETPYDINNFYSY
NFDVTKGPVQVKWMEGATTNVCYNLLDKNVRNGMGDKVAFYWEGNDPEDYSKITYKKLLE
EVCRFSNVLKSKGVVKGDRVAIYMPMIFEIVITMLSCARIGAVHSIVFAGFSSDSLAERM
ADCKCKVLVTADSVYRGDKLLNIKSLCDIAMDKAKNFGHEVSTCIVVRHLPRLYRSMNTS
NGTNGSNSDIIDLHSDVPWTDGRDYWWHDEMDDVEPSCYPVWVSAEDPLFMLYTSGSTGK
PKGVLHTTGGYLLYAATTFKYVFDYHPGDVYWCTADIGWITGHSYVVYGPLANGATSVIF
EGTPFYPDNGRYWSVIEKYKVTQFYTAPTAIRALMKFGEEPVKKHNLDSLKVLGSVGEPI
NPEAWLWYYQHIGKERCSIADTFWQTETGGHVITPLPGCTPMKPGSASFPFFGVKPILLD
ESGKEIEGVGEGYLVFNKPWPGIMRTLFGNHERFQSVYFSKFPGYYCTGDGARRDEDGYF
WVTGRVDDMLNVSGHLMSTAEVESVLTEHPDVSEAAVVSRPHPIKGECLYCFITPNHGVT
FTPQLSSELVKKVRESIGPFAMPDVIQHAPGLPKTRSGKIMRRVLRKVAINDREVGDIST
LADEHIVEELFKNRPEKS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaacgtatacctcccgtatagcgcgacatccgagaaggctcacgtcaagtct
atggaacattaccgggaaatgcacaataaatcattggagtcgaccgcgcaattttggtcc
gaaatcgcgtcacaatttcactgggaaacgccgtacgacatcaacaacttttactcatac
aacttcgacgtgaccaaagggcccgttcaagtcaaatggatggaaggtgccactacaaac
gtgtgctacaacctactggacaagaacgtgcgcaatgggatgggtgacaaagtagctttt
tactgggaaggcaatgatccggaagactatagcaaaatcacatataaaaaacttttagag
gaagtttgccggttttcaaatgtattgaaatctaaaggcgtagttaaaggtgaccgtgtc
gcaatttatatgccaatgatttttgagatcgtgattactatgttatcgtgtgcaagaatc
ggcgcagttcactctattgttttcgcaggattttcatccgattcgctagcagagcgtatg
gccgactgtaagtgcaaggtccttgtgacagctgatagcgtatacagaggagacaaattg
ttaaacattaaaagcctatgtgatattgcgatggacaaagccaagaattttggccacgaa
gtttcaacttgtattgtagttcgtcacttaccgcgtctttacagatccatgaacacatct
aatggtacaaacgggtctaactccgacatcatagatctacattcagacgtgccatggact
gatggacgagattattggtggcatgatgagatggatgatgtagaaccctcttgttatcca
gtctgggtgtctgcagaagatccactatttatgttatacacgagtggatcaacaggaaaa
ccaaaaggagtacttcatacaactggtggatacttattatacgctgctactactttcaag
tatgtttttgattaccacccaggggatgtttattggtgcacagcagatattggttggatc
actggccactcttacgttgtttatggacctttagcaaatggggcaacttcagttatattt
gaaggaacaccattttatccagataatggaagatactggtcagttattgaaaaatacaaa
gttacacagttttacactgcaccgacagccattcgtgcacttatgaagtttggagaagaa
ccagtgaagaaacataatctcgattcactaaaagtattgggttcagtaggtgaaccaata
aacccagaagcttggttgtggtattaccaacatattggtaaagaaagatgttccatagca
gacacattttggcaaactgaaaccggagggcatgttataactccactaccgggttgtaca
ccaatgaaaccaggatcggcatcatttccgttctttggtgttaaaccaatcctattggat
gaaagtggtaaagaaattgaaggagttggagagggatacttagttttcaataagccttgg
cccggtataatgcgcacattatttggaaatcatgaacggttccaatcagtttacttcagc
aaatttccaggatactattgtacaggagatggtgcaagaagagatgaagatggatacttt
tgggtgactggaagagtggatgatatgttaaatgtatctgggcatttgatgagcactgct
gaagtggaatctgtactcacagaacacccagatgtttctgaagctgcagttgtatcaaga
ccacatccaatcaaaggagagtgtctttattgttttattactcctaatcatggtgtgact
tttacaccacaactttcatccgagttggttaaaaaagtgagggaatcgattgggcctttt
gctatgccggacgttattcaacatgcaccaggtcttccaaaaactcggtctggaaaaata
atgagaagagtcttacgaaaagtagcaatcaatgacagagaagtaggtgacatatcaaca
ttagctgacgaacatatagttgaagaactattcaaaaatcgaccggagaaatcataa

DBGET integrated database retrieval system