KEGG   Acyrthosiphon pisum (pea aphid): 100163830Help
Entry
100163830         CDS       T01076                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100163830
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100163830
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100163830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 691 aa AA seqDB search
MGGKHSKMDPMDVEVPELQKQLDRDSYLKPYEREFKRRYACFLDYLERVKDESNLESFTT
AYKTFGLHFNNDGSVYCLEWAPGAKQLYLTGDFNGWNRENYPYKKLEYGKWELTIPPNSD
GTPVIKHLSEIKIVVESHHGEKMDRLSPWATYVVQPPREEGVTFKQKVWNPSDHVYQFKY
PKVPKPSSLRIYECHVGIATSEYKVGTYQEFKDNMLDRILELGYNTIQIMAIMEHAYYAS
FGYQVTSFYAASSRFGTPEDLKELVDVAHSKGLYVMLDVVHSHASKNVLDGLNQFDSTDA
GYFHSGPNGSHPLWDSRLFNYSEYEVLRFLLSNLRWYIEEYNFDGFRFDGVTSMLYHSRG
AGQGFSGHYDEYFGLNVDSDALIYLMLANYMLHTFYPNCITIAEDVSGMPSSCRPVSEGG
LGFDYRLGMAIPDMWIKLLKEVKDDDWNMGDIVHTLTNRRWMEKTVSYAESHDQALVGDK
TVAFWLMDKEMYTHMAVSSDPSLIIDRGIALHKMIRLITNSLGGEAYLNFIGNEFGHPEW
LDFPRDGNNSSYHYARRQWNLVDDESLKYKYLNNFDKSMNHLENKYGWLNDNPGYVSLKH
EDDKIIAFERGGLLFVFNFHPTKSFTEYKIGLNLSGSLKIVLNSDNSEYGGHSRIDNNIT
YPTINGDWSGRQNHIFLYLPTRTALVFSTSN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaaacactctaaaatggatcccatggacgtcgaagtgcccgaactccaaaaa
cagctggatcgcgattcctatttaaaaccctacgaaagggaattcaaacgcaggtatgcg
tgctttttggattatttggaaagagtaaaagatgagtcaaatttagaatcgtttacaacg
gcttataaaacgtttggtcttcattttaataatgatgggtctgtgtattgcttggaatgg
gctcctggagctaaacaactctatctcactggtgatttcaatggttggaatagagaaaat
tatccctacaaaaaactggaatatggaaaatgggaattaactataccaccaaacagtgat
ggaacaccagttattaaacacttatcagaaataaagattgtagttgaatctcatcatggt
gaaaaaatggatcgtttatcaccttgggcaacttatgtagttcaaccaccccgtgaagaa
ggagtgacattcaaacaaaaagtttggaatccatcagatcatgtatatcaatttaaatat
cctaaagtaccaaaaccatctagtttacgaatatatgaatgtcatgttgggattgccaca
tcagaatacaaagttggaacttaccaagaatttaaagataatatgttagatcgtattctg
gaattaggatataatacaattcaaataatggccattatggaacatgcctactatgcttct
tttggatatcaagtgacaagtttttatgcagcttcaagtcgctttggaacaccagaagat
cttaaagaattagttgatgttgcacatagtaaaggactatatgttatgttagatgttgta
cactcccacgcatcaaaaaatgtattagatggtttgaatcagtttgatagtacagatgct
ggttactttcatagcggacctaatggaagtcatcccctttgggacagcagacttttcaat
tattctgagtatgaagtgttacgatttttactgtcaaatttgcgatggtatattgaagaa
tataattttgatggctttagatttgatggtgttacatctatgctataccattctcgaggt
gctggtcaagggttcagtggacactatgatgaatattttggtcttaatgttgattctgat
gcattgatttatttgatgttggcaaactacatgctccatacattctaccccaattgcata
actatagctgaagatgtgtctggaatgccttcatcatgtcgacctgtaagtgaaggagga
cttggatttgattatcgtctaggaatggctatacctgatatgtggataaaactgctgaag
gaggttaaagatgatgattggaatatgggagatattgttcatacacttacaaatcgaagg
tggatggaaaaaacagtttcctatgccgaatcccatgaccaggctcttgttggagataaa
accgttgcattttggttgatggataaagaaatgtatacacatatggctgtctcaagcgat
ccgtctttaatcattgatcgtggaatagcattacacaaaatgattcggttgatcaccaat
agtcttggtggtgaagcatatttaaattttattggtaatgaatttggccatcctgaatgg
ttagacttccctcgtgatggcaataatagttcatatcattatgccagacgacaatggaat
ttagtcgatgatgaatcattaaaatataagtatttaaacaattttgataaaagtatgaat
catttagaaaataaatatggatggttaaatgacaatcctgggtatgtgagtttaaagcat
gaagatgataaaataattgcatttgaaagaggtggcttattatttgtattcaatttccat
ccaaccaagagttttacagaatacaaaatcggtttgaatttgtcaggctcgttaaaaata
gttttaaatagtgataattcagaatatggaggacacagtcgcattgataacaatattaca
tatccaactatcaatggcgattggagcggtagacaaaatcatattttcctatatttacca
acaagaactgctctagttttttctacatcaaactga

DBGET integrated database retrieval system