KEGG   Acyrthosiphon pisum (pea aphid): 100163930Help
Entry
100163930         CDS       T01076                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:api03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:api03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 470 aa AA seqDB search
MSKKTSTNKKERKNLRKDDGSTILKVLTLYEYLIKLPEAVQDRLYIHPPTCLAVFRVLPD
IAQVFTLRILFIEQPVPLSALSSWVPAKYSRELEESIEVAINLHIWKLTSVSGGLKGWIL
NSTFKKKLKVAIMSGGRTTVPNSDETALKARDIDILDSYAYERWECILYYMVGSKHKGIS
SDAVRVLLNAGLMVRDTDNSPVITSTGYQFLLLDMATQVWYFMLHYMETVESRGLDLAQY
LIFLFQIHLSTLGWDYITDGMPENLQTFLQHLQEFGLVYQRKLKAGRFCPTRLVIEMGRE
NSHTSKRMKKKERYIVVETNFRIYAMTDSDLKVALVALFTHMLYRFPNMSAGILTRDSVQ
TALRNGITAAQIVRFLTVHTHPQMQECGMPQTVIDQIYLWEYERNRLTYRDGVLYSDINT
PNDYEAIKNYAADIGALLWCDERQRNIIVSTDGHNDVTTFWKKQPKSNPF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaaccagcacgaacaagaaggagcggaagaatttgcgtaaagacgacggt
tctacaatactgaaagtcctgacattatacgaatacctcatcaaacttccagaagccgtt
caagatcggctatacatacatccgccgacctgcctagcagtgtttagagtgttacctgac
attgcgcaggtgttcaccttacgtatattgttcatcgaacaaccagtaccgctatcagct
ctttcatcctgggtacctgccaaatattcccgtgaacttgaggaatctatagaggtagcc
atcaatttacacatatggaaattaaccagtgtatctgggggcctcaagggatggattcta
aattctacgttcaaaaagaaactgaaagtggccattatgagcggtggccgtactacggta
cccaacagcgatgagacggctctaaaagcaagagatatagacattttagattcatatgcg
tatgaacggtgggaatgcatattatattatatggttggttctaaacataaaggtatatca
tcagatgcggtcagagtgttgctaaatgcaggtcttatggtcagagacacggataatagt
ccagttattacatcaacgggatatcagtttctactgctggacatggccactcaagtatgg
tatttcatgctccactatatggaaacggttgaatcgaggggtcttgatcttgctcaatat
ctgatattcctgttccaaatacatcttagtactttaggatgggattatataacagatgga
atgcctgaaaaccttcaaacgtttttacaacatcttcaagaatttggattagtttaccaa
aggaaacttaaagctggacgtttttgtcctactcgattagtaattgaaatggggcgagaa
aatagccatacttcaaaacggatgaaaaagaaagaacgttatatagttgtagaaaccaac
tttcggatttatgctatgactgattctgacctaaaagttgccttagttgcattatttact
catatgctatacagatttccaaacatgtccgctggtatactaacaagagattcagttcaa
acagcattacgtaatggcattactgctgcacaaatagtgagatttcttaccgttcataca
catccacaaatgcaagagtgtgggatgccacaaactgtaattgatcaaatttatttgtgg
gaatatgaaagaaatcgactaacatacagagatggtgtgttatacagcgatataaataca
cctaatgattatgaagcaataaaaaattatgctgctgatattggggcattgttgtggtgt
gatgaaagacaaaggaacattattgtaagcactgatggacacaatgacgtaacaacgttt
tggaaaaaacaaccaaaatctaatccattttaa

DBGET integrated database retrieval system