KEGG   Acyrthosiphon pisum (pea aphid): 100164039Help
Entry
100164039         CDS       T01076                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100164039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MAPGGKSAGGKAMKKSGKAQKNIAKSDKKRKPKRKESYAIYIYKVLKQVHPDTGVSSKAM
SIMNSFVNDLFERIASESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaggaggtaaatccgcaggcggcaaagcgatgaagaagtccggcaaggctcaa
aagaacatcgccaaatccgacaagaaacgcaagcccaagaggaaagaatcgtacgctatc
tacatctacaaagtgttgaagcaagtgcacccagacaccggcgtttcctcaaaggcgatg
agcatcatgaacagttttgtcaacgatctcttcgagcgtatcgcttccgaatccagtcgt
ttggctcactacaacaagcgttcgaccatcaccagtcgggaaatccaaaccgccgtccgc
ctcttgttgcccggcgagttggccaagcacgccgtcagtgagggaaccaaagccgtcacc
aaatacacgagctccaaataa

DBGET integrated database retrieval system