KEGG   Acyrthosiphon pisum (pea aphid): 100164179Help
Entry
100164179         CDS       T01076                                 

Definition
l-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100164179
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     100164179
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     100164179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 717 aa AA seqDB search
MDQKPQLESRPNGDIPKSPATIGVSDENGHPININESQSFRRLSSPSPSYLGSTPSQSYL
GSTPPQSFRRRCDSMTKTEDGDQNESKVLVIYTGGTIGMIRNDDNMLVPTPSNGNSTDFL
MEHKMRQDHRLYDAKYAQHKYGASMNCSPLVLPMVKGFRRIVYSVYQYPELLDSSNMCMR
DWRSIAEDIWQAYELYDGFVVLHGTDTLAYTASALSFMFENLGKTIIITGAQLPVFDLRS
DGSDNFVTSLLMAGNYCIPEVTILFHNKLLRGNRTVKVDCESFAAFDSPNLAPLXXXXIG
TAVSFRQIFRPRSIEKFAVHLQLDENVSLLRIFPNITADTVRTFLQPPIRGVVLQTYGAG
NLPGNRADIMAELKAATDRGVIVFNCSQCFKGSVTAVYQTGHVLNQVGVISGNDITPEAA
LAKLSYVLSKDDWDLSTKRMMLGANLRGEMSGGPPKPARKNRAADEWDLVDAVARTLLHV
NGSQELTALGGVLFPAMLGNAVARSDLSKLDELKGFGADFSAQNADGRTALHLACALGDV
RIVRYLLLNGASVHIKDKFDRTPLIDAVENDRNDVVALLRRCGAHLNSPAKHVGQQLCNA
AAKGNLQRLRSYAAAGADPYSANDMYGRTPLHAAALTNQTEVVEYLLSLHVAVFALGHVD
AGPPADLLGVTPVDVARAAGHAVLAEKLQQHFKNPNGYEKKQLPQLNGDGVEHKEKA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaaccacaactagaatcgcgaccgaacggtgacatcccgaaaagcccagcc
acgatcggcgtgtccgacgagaacggacaccccattaatattaacgagtcgcagtcgttt
cggcgtctgtcctcgccttcgccgtcgtatctcgggtccacgccgtcgcagtcgtacctt
gggtccacgccaccacagtctttccgcagacggtgcgactcaatgacaaaaaccgaggat
ggcgaccagaacgagtctaaagtgttggtcatatacacgggtggaaccatcgggatgatc
aggaacgacgataacatgttggtgcccacacctagcaacggaaattccaccgattttctt
atggagcacaagatgcgtcaggaccaccggttgtacgacgcaaagtacgcacaacacaag
tatggcgcgtccatgaactgcagtccgctagtattgcccatggtcaagggattccggcgg
atcgtttactcggtgtatcaatacccggagctgttagactcgagcaacatgtgcatgcgt
gattggcggagcatagctgaagacatatggcaagcgtatgaactatacgacggattcgtc
gtgttgcacggtaccgatacgttggcctacactgcgtccgcactgtcgtttatgttcgag
aacctcggcaagaccatcatcatcacgggtgctcagttgccagtttttgacttgcgaagc
gacggaagcgataactttgtcaccagtttgctgatggccggtaactattgcatccccgag
gtgacgattctgttccataacaaacttttacgtggcaaccgtactgtcaaggtggactgc
gagagcttcgctgcgttcgactcacctaacttggcgccgctnnnnnnnnnnngtattggt
actgcagtgtcgtttagacaaattttccggccgaggtccatcgagaagttcgcagttcac
ctacagctcgacgagaacgtcagtttgctgcgcattttccccaacattacagctgacacg
gttcgtacgttcctgcagccacccatcagaggtgtagtgcttcaaacgtatggagctgga
aacttgcccggaaaccgcgccgacatcatggccgagctgaaagccgccaccgatcggggt
gtcatcgtgttcaactgcagtcagtgcttcaagggatcggtgacggccgtataccaaacc
gggcatgtgctgaaccaggttggcgtcatatcaggcaacgacatcactcccgaagcggca
cttgccaaactctcatacgtgctatccaaggatgactgggacctgagcaccaaacgaatg
atgcttggagcaaatctgagaggtgagatgagcggtggaccgccaaaaccggcaaggaag
aaccgtgccgcggatgagtgggatctagtggacgcagttgcccgcaccctgttgcacgtg
aacggatctcaagaattgactgcgctcgggggcgttctgtttcccgcaatgctgggaaat
gccgtcgctcgttcagacttgagcaaactggacgagctcaaaggctttggagctgacttt
tccgcacaaaacgctgacggccgtacagccttgcacttagcgtgcgccttgggagacgtc
cgcatagtccggtacctgttattgaatggagccagcgtacacatcaaagacaaatttgac
aggacgccgctgattgacgccgtcgaaaacgaccgaaatgacgtggtcgcgctgttgcga
aggtgtggtgcccatctcaactcgcccgccaagcatgtcggtcaacagctgtgcaatgct
gcggccaagggaaacttgcagaggctgcgatcttacgcggctgctggagccgacccgtat
tcggccaatgacatgtacggcagaacaccattgcacgctgccgcgctcaccaaccaaacg
gaagtggtcgagtacttgctgtcgctgcacgtagccgtctttgcgctcggacacgtggac
gctgggcctcctgccgacctgttgggcgtcactccggtggacgttgctcgggcggccggt
cacgcggtcctcgccgaaaaacttcaacagcacttcaaaaatcccaacggatacgaaaag
aagcagttgccacagctgaatggtgacggagtggagcacaaggagaaggcgtag

DBGET integrated database retrieval system