KEGG   Acyrthosiphon pisum (pea aphid): 100164302Help
Entry
100164302         CDS       T01076                                 

Definition
probable E3 ubiquitin-protein ligase HERC4-like
Orthology
K10615  
E3 ubiquitin-protein ligase HERC4 [EC:6.3.2.19]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:api04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1053 aa AA seqDB search
MYCWGNTINGELGLGGIEENYILSPEEIVNFESVNNIKSVACGNNHTLAVTEDGQLYACG
SNDFGQLGHDGCRTKLQKIPGVESLVMTSVACGEAHSMALNEWGQLYTWGSDSCGQLGLE
TDEGIQYKPKIVKTLASMLLVQISCGYKHCMALTNHGELYTWGSNEFGQLGLGLGPGNVS
KPTLVNSLVGLPISFIACGGYHSFVVSKSGAVFGWGKNDFGQLGINSQTSLSSPAQLKTI
RTVKVKYIAGGEDFSVFLTYDGGVFTCGAGMYGQLGHGSFSNEIVPRKVLELMGSTVTQV
TCGRRHTLTLVPSKGRVYSFGLGSVGQLGTKSSINSNTPQLVLGPWLSPSGTSMIETNKQ
YVVKSIYAGGDQCFVRVTHKSLDICPDDYRIIQESSQIWTVKLSDVINLSTILPENPVDQ
ERMSFVEIVMSSLSCLNGSFLMLNDIHYTCTENNHGIDFDLAALCFDAISHVRNTSLSDL
ILTSLASAVDSLSLPSPDVESLRFYLTLPMYHEFKNITNATILQVPYAEALLNLSSTDSN
TIEFWISSMPVVYFNTLLMVYKNVFIDQLNTNTNSTEQKCWDKALIVAASMLAKLNKLNS
NLNGHQVKKGQLKVPYTSFYIPQLSDKIDIPSDYMKWMRADNNGIKYQDFYFCNYPFLFN
AEAKTILLQVDQKVQMQQAMQAAATRAFTQMLFLDVNQHNLANQFIELNVSRNNLVVDTI
RELSLYTQHDYKKPLKVKFIDEEAEDAGGVRKEFFMLLIKEILDPKFGMFVNYEDTNMIW
FNDSSFEDVTMYYLIGLMCGLAIYNFIIIDLPFPVALYKKLLNEPITLQDFKDLDPMVGI
SFEELLAYNKPDLDEVFNLTFEITREVYGEIQTIPLKPDGANIIVDQNNKHEFVDLYVDM
VLNRRVEKQFNVFKDAFLKVCGGRVLRLFHSQELMAVVVGNQDYNWIEWENNAEYKNGYS
KDDETIKMFWEVFHEFNIDDKKKFLLFLTGSDRVPIMGMKAIKIYIQPTLDDNFLPVAHT
CFNLLDLPKYKSKGKLKYKLTQAIHQTQGFSLV
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgtattgttggggcaatacaatcaacggggaactcggtctgggtggtattgaggaaaac
tatatcctcagtccagaagagatagtcaattttgaaagcgtgaataacattaaatcagtg
gcttgtggaaataatcatacacttgccgtaactgaagatggacaattatatgcttgcggt
agtaacgattttggtcagctgggacatgatggatgtcggacaaaactacaaaaaattcca
ggggttgaatctttggtgatgacaagtgttgcatgcggagaagctcattcaatggcactt
aatgaatggggacagttatacacttggggttctgactcctgtggacaattaggacttgaa
actgatgaagggattcaatataaaccaaaaatcgtcaaaacattagccagtatgctatta
gttcaaattagttgtggatataaacattgtatggctctgacaaaccatggagagttgtac
acttggggctcaaatgaatttggacagttgggccttggacttggccctggtaatgtgtca
aagccaacattggttaattcactggttggcttacctatttcatttattgcctgtggtgga
tatcatagttttgttgtatcaaaatcaggtgctgtgtttggttggggaaaaaatgatttt
ggacaactagggataaacagtcaaactagcttatcatcacctgcacaactgaaaacaata
cgaactgtcaaagtaaagtatattgctggaggagaagatttctcagtattcttgacatat
gatggtggagttttcacatgtggtgctggtatgtatggtcaattaggacatggttcattt
tcaaacgaaattgttccaagaaaagtgctagaactcatgggcagtactgtgactcaagtt
acatgtgggcggagacatactttgactttagtaccttcaaagggtcgagtctactcattt
ggacttggtagtgttggccagttaggtacaaaatcatctattaactcaaatacaccacaa
ttagtattaggaccttggctatctccttctggaacatctatgatagaaacaaataagcaa
tatgttgttaaaagtatttatgcgggaggtgatcaatgttttgttagagtcactcataaa
tcgctcgatatatgtccagatgattatcgaattattcaagaaagttctcaaatttggact
gtaaagctttcagatgtgataaatttatcaaccatcctaccagaaaatcctgttgaccaa
gaaagaatgtcgtttgtagaaatagtgatgagcagtttgtcatgtttaaatggctcattt
ttaatgttgaatgatattcattacacttgtacagaaaataatcatggtatagattttgat
ctcgctgcactatgttttgatgccataagtcatgtacgcaatacttcgttgagtgattta
atattaacatcattagccagtgcagttgattctttatcattgccttctcctgatgtggag
tcattgaggttttatctaaccttacctatgtaccacgagtttaaaaatattacaaatgct
accatacttcaagtgccttatgctgaagcattactaaatctgagcagcacggattcaaat
actatagagttttggatttcttcaatgccggttgtgtattttaataccttattaatggtg
tataaaaatgtatttattgatcaattgaacaccaatacaaattctactgaacaaaaatgt
tgggataaagcattgatagtggctgcttcaatgttagctaaattaaataaactaaattcc
aatttaaacgggcatcaagtgaagaaaggccaattgaaagtgccatacacctcattttat
attccacaattatctgataagatagatataccttctgattacatgaagtggatgcgtgcc
gataataacggaattaaatatcaagatttttatttttgtaactatccttttctgttcaat
gctgaagctaagacaatactcttacaagttgatcagaaagtacagatgcaacaagcaatg
caagctgcagcaacaagagcatttacgcaaatgctatttttggacgtgaatcagcataat
ttagcaaatcaatttattgagcttaatgtctcacggaacaacttagttgtagatacaata
cgtgaattgtctctttatactcaacatgattataaaaaacctttgaaagtgaaatttatt
gatgaagaagctgaagatgctggaggagtaagaaaagaattttttatgcttttgattaaa
gagattttagatccaaaatttggtatgtttgtaaattatgaagatacaaacatgatatgg
tttaatgactcttcctttgaagatgtcacaatgtattatcttattggtttgatgtgtggc
ttagcgatatataattttattatcatagacttaccatttcctgtagcattgtacaaaaaa
ctacttaacgaacctattacccttcaagattttaaagatctggatccaatggtgggtata
agttttgaagaattattggcttataataaacctgatcttgatgaagtatttaatctcact
tttgaaatcactagagaagtttatggagaaattcaaacaattccattgaaaccagatggg
gctaatataatagttgatcaaaataataaacatgaatttgtcgatttgtacgtagatatg
gtattaaaccgtagagttgaaaaacaatttaatgtattcaaagatgcatttttaaaagtg
tgcggtggacgcgtattaagattgttccattcgcaagaattaatggctgttgttgtgggc
aatcaagactacaattggattgagtgggagaataatgctgagtataaaaatggttacagt
aaagacgacgagacaataaaaatgttttgggaagtatttcatgagtttaacattgatgac
aaaaagaagtttttgctatttcttacaggaagcgatcgtgtacccattatgggaatgaaa
gcaataaaaatttatatccaacccaccctagatgataacttcttgcctgtggcacacaca
tgtttcaaccttttagatttaccgaaatataaatccaaaggaaaactgaagtataagctg
actcaagccattcaccagacacaaggattttctctggtctaa

DBGET integrated database retrieval system