KEGG   Acyrthosiphon pisum (pea aphid): 100164325Help
Entry
100164325         CDS       T01076                                 

Definition
(RefSeq) cyclin-dependent kinase 4
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo RIO1 DUF3979
Motif
Other DBs
NCBI-GeneID: 100164325
NCBI-ProteinID: XP_001947810
APHIDBASE: ACYPI005353
UniProt: J9JY47
Position
Un
AA seq 429 aa AA seqDB search
MCVPRNPPEVPLRLLLIRRHRLRLRRKSPSPSGFSRCHPIAKPFATGRRCPQVVATRPSR
SVSRTLRCETILSPRVRCILYVQSARHLLCHLVPILLKPAIHKLLTSTVTTMVSPLSRLQ
SKTFPAMSSMLQEKENYEELNQIGNGAYGTVYKGRDLVNKGKFVAMKKIKIPLAQDGVPM
TTLREIALLKQLDQQQHPNIVKLLDVVHGPRLYNEKCMTLYLVFEHIEQDLATYMARCPK
PGMSSEIIKNVMRQILSGVDFLHCNRVVHRDLKPQNVLVSSDLRIKIADFGLAKIYDFDM
KLTSVVVTLWYRAPEVLLGLPYATAVDVWACGCIMGEMYKLSPLFDGESEAEQLDRIFRV
IGLPSALNWPKNVSLLRSSFESYPQTCLKTVIPDICSKGTDLLMKMLMFDSTERVSAREA
LKHPYFNET
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtgcccaggaatccaccggaagtgcctcttcgtcttctcctcatacgtcgtcat
cgtcttcgtctgcgtcgtaaaagtccgagtccatccggtttttctcgttgccaccctata
gccaagccctttgccacgggcagacgctgtccacaggtggttgcgactcgtccatcgcga
tccgtgtcaaggacgttgcgttgtgaaaccatcctctcgccccgtgtgcgttgtatattg
tatgtgcaatccgcgcgtcatttactctgtcatctcgtcccgattttgttgaaaccagca
atccacaaactgctcacgtcgactgtcaccaccatggtgtcaccactatcccgattgcag
tccaaaacgttccctgctatgtcttcaatgctacaggaaaaggaaaactatgaggagctc
aatcagataggaaatggagcatatggtaccgtgtacaaaggccgagatcttgtcaataaa
ggaaaatttgtagccatgaaaaagataaaaattccattggcccaagatggtgtaccaatg
actactcttcgtgagattgctctactcaagcaacttgatcaacaacaacatccaaatatt
gtcaaacttttggatgtggtacatggtccgagactatataacgagaaatgtatgacactt
tatttggtgtttgaacacattgaacaagacttagccacctacatggcacgatgtccaaaa
ccgggaatgtcttctgaaatcattaagaatgttatgcgacaaatattatcaggagttgac
tttcttcactgtaatcgtgttgtacatcgtgatctcaaaccacaaaacgttttagtgtca
agtgacctcagaattaaaattgctgattttggtctagccaaaatatatgattttgatatg
aagttgacctcagttgtcgtaacattatggtatcgagcacctgaagttttattaggttta
ccttacgctactgcagttgatgtctgggcctgtggctgtataatgggagagatgtacaaa
ttatctcctttatttgatggcgaatctgaagctgaacagttagataggatatttagggtg
attggtctaccatctgcattaaattggccaaagaacgtttctctattgaggagttctttt
gagtcttatccacagacttgtttgaagactgtaatccctgatatatgttctaagggaaca
gatttgttaatgaaaatgttgatgtttgacagtactgaacgagtgtcagctcgtgaggct
ttgaaacatccatactttaatgaaacataa

DBGET integrated database retrieval system