KEGG   Acyrthosiphon pisum (pea aphid): 100164325Help
Entry
100164325         CDS       T01076                                 

Definition
cyclin-dependent kinase 6-like
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 429 aa AA seqDB search
MCVPRNPPEVPLRLLLIRRHRLRLRRKSPSPSGFSRCHPIAKPFATGRRCPQVVATRPSR
SVSRTLRCETILSPRVRCILYVQSARHLLCHLVPILLKPAIHKLLTSTVTTMVSPLSRLQ
SKTFPAMSSMLQEKENYEELNQIGNGAYGTVYKGRDLVNKGKFVAMKKIKIPLAQDGVPM
TTLREIALLKQLDQQQHPNIVKLLDVVHGPRLYNEKCMTLYLVFEHIEQDLATYMARCPK
PGMSSEIIKNVMRQILSGVDFLHCNRVVHRDLKPQNVLVSSDLRIKIADFGLAKIYDFDM
KLTSVVVTLWYRAPEVLLGLPYATAVDVWACGCIMGEMYKLSPLFDGESEAEQLDRIFRV
IGLPSALNWPKNVSLLRSSFESYPQTCLKTVIPDICSKGTDLLMKMLMFDSTERVSAREA
LKHPYFNET
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtgcccaggaatccaccggaagtgcctcttcgtcttctcctcatacgtcgtcat
cgtcttcgtctgcgtcgtaaaagtccgagtccatccggtttttctcgttgccaccctata
gccaagccctttgccacgggcagacgctgtccacaggtggttgcgactcgtccatcgcga
tccgtgtcaaggacgttgcgttgtgaaaccatcctctcgccccgtgtgcgttgtatattg
tatgtgcaatccgcgcgtcatttactctgtcatctcgtcccgattttgttgaaaccagca
atccacaaactgctcacgtcgactgtcaccaccatggtgtcaccactatcccgattgcag
tccaaaacgttccctgctatgtcttcaatgctacaggaaaaggaaaactatgaggagctc
aatcagataggaaatggagcatatggtaccgtgtacaaaggccgagatcttgtcaataaa
ggaaaatttgtagccatgaaaaagataaaaattccattggcccaagatggtgtaccaatg
actactcttcgtgagattgctctactcaagcaacttgatcaacaacaacatccaaatatt
gtcaaacttttggatgtggtacatggtccgagactatataacgagaaatgtatgacactt
tatttggtgtttgaacacattgaacaagacttagccacctacatggcacgatgtccaaaa
ccgggaatgtcttctgaaatcattaagaatgttatgcgacaaatattatcaggagttgac
tttcttcactgtaatcgtgttgtacatcgtgatctcaaaccacaaaacgttttagtgtca
agtgacctcagaattaaaattgctgattttggtctagccaaaatatatgattttgatatg
aagttgacctcagttgtcgtaacattatggtatcgagcacctgaagttttattaggttta
ccttacgctactgcagttgatgtctgggcctgtggctgtataatgggagagatgtacaaa
ttatctcctttatttgatggcgaatctgaagctgaacagttagataggatatttagggtg
attggtctaccatctgcattaaattggccaaagaacgtttctctattgaggagttctttt
gagtcttatccacagacttgtttgaagactgtaatccctgatatatgttctaagggaaca
gatttgttaatgaaaatgttgatgtttgacagtactgaacgagtgtcagctcgtgaggct
ttgaaacatccatactttaatgaaacataa

DBGET integrated database retrieval system