KEGG   Acyrthosiphon pisum (pea aphid): 100164331Help
Entry
100164331         CDS       T01076                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100164331
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100164331
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100164331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 545 aa AA seqDB search
MSKIHNLICYKKNNSQKSMSAAEETFVGAIDEGTSSTRFLVFSSKTHQPIASHQISTNNI
TLHEGWVEQDPEDILMKVKETIAVTCEKLKMMNISPSAIAAIGVTNQRETTLVWDKYTGK
PLYNAIIWMDMRTQSIVDRFINKRIPNCHTLDEKKRHLQFKCGLTMNPYFSVFKLVWLIE
NVPEVSKAIQEERCMFGTMDSWLIWNLTGGINGGVHITDVTNASRTMLMNIHSLRWDKAL
IEFFEMPSKLLYPEIRSCSEVYGRMTEGPLSETPISGCIGDQQAALMGQMCFLAGQAKCT
FGTGCFLLYNTGRKPVISTHGLLTTVAYKMGKQTDPIYALEGSVAVAGSATKWLKDNLCI
VDSYKNMEVMADSVEDTNGIHFVPAFSGLYAPYWKSDARGTITGLTMETTDAHLMRATLE
GICFQTKDVMQSMQSDTGHPITALNVDGGMSTSDTFLKILTNVCCLPVVRPKMVETTALG
AALAAGFAVGIWSMHSVQSNCDTFIQTLSEEEQKSEYILWKKAIDRSIGWNKDDEENEYD
DFAGF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatacataacttaatctgttacaagaaaaataattcacaaaaatcgatgtct
gctgctgaagaaacatttgttggtgctattgatgaaggcaccagtagtacacgtttcttg
gtgttttcatcaaaaactcaccagccaatagccagtcatcaaataagtacaaataacata
actttgcatgaaggatgggtggaacaagatccagaggatatattaatgaaagtcaaagaa
acaatagctgtaacatgcgaaaaactcaaaatgatgaacatttctccttcagctattgct
gcgataggcgtgacaaatcaacgagaaactactttagtgtgggacaagtatacagggaaa
ccattatacaatgctataatatggatggatatgagaacacaatcaatagttgatagattc
atcaacaaacgaattcctaactgtcatacgttagacgaaaaaaaaaggcatttacaattc
aaatgcggcttaacgatgaatccatactttagtgtgttcaaattagtttggctaatagaa
aacgtacccgaagtttcaaaagccattcaagaagagaggtgtatgtttggtacaatggat
tcatggctaatttggaatctaacaggcggtataaatggaggagttcatataactgatgtt
actaatgcttctcggaccatgctgatgaatattcactcattaagatgggataaggcattg
attgaattttttgaaatgccaagcaaattattatatccagaaatacgaagctgttcggag
gtgtacggtcgtatgactgaaggaccactatcagaaacaccaatatctgggtgcataggt
gatcagcaagctgcccttatgggccaaatgtgttttttggcaggtcaagccaagtgcaca
tttggtactgggtgctttttgttatacaacactggtcgtaagccagtgatttcaactcac
ggccttttaactaccgtggcttacaagatgggtaaacaaaccgatcccatttatgcgctt
gaaggatcagtggctgtagctggatctgctacaaagtggttgaaagataatctatgtatc
gtggatagttacaagaatatggaggtaatggccgatagtgttgaagacacaaatggaatt
catttcgttcctgctttttctggactttatgcaccatactggaaaagtgacgcacgtgga
actatcacagggttgactatggagacaacagacgcacatttaatgcgagcaactcttgaa
ggaatctgtttccagacaaaagatgttatgcaatctatgcagtcagatactggccatcct
attacggcattgaatgttgatggtggtatgtctactagcgatacatttttgaagattctt
acaaatgtttgttgtcttcctgtcgtgcgccctaaaatggtggaaactacagctctaggc
gccgctctggcagctggttttgctgttggtatatggagtatgcacagtgttcaatcaaac
tgtgacacttttattcagactttatcagaagaagaacaaaaatccgagtatattttgtgg
aaaaaagcgatagaccggagtataggttggaacaaagatgatgaagaaaatgagtatgat
gactttgctggtttttag

DBGET integrated database retrieval system