KEGG   Acyrthosiphon pisum (pea aphid): 100164394Help
Entry
100164394         CDS       T01076                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100164394
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100164394
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100164394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 776 aa AA seqDB search
MSDCDDVNNDKGGVPEYGWKVDFDHQFPDPRTPSYMPRIKQILQLLPLIIRYVFYMLLCY
LKGQKPIMDFLFPIKSKHMYGVPLGGIGGGTIGRGFKGEFCRYQVVPGMYEYESVQANQF
IVNIQNSENITVYNNVLSCLKCNNKTLYNWKWDFPSNQCKYTGLYPRSWTEYLIPEFHIR
LICKQISPIIPHNYKDSCIPGGVFIWTVENNSDQQYSISLTFTFASGNGISSYHSDEPSC
EPFNLNKDGTEVAGSLIHNCFKEMKCTYVIGGLIKEGAAFSQLNFDPKGNGMTISKSLHL
FGELRDMQLGPSNIYSKYYTKFFDKNGTAGPEIMHYSMQNFKKWEQEIEKWQNPILNNPL
LPDWYKSAIFNEVYFVADGGTIWFLPLKEDYERLDVTDPRYQYGYFGYLEGHEYRMYNTY
DVHFYASFTLAKLWPKLQACIQYKFRDTIDNALNITRKHLSCGTRGLRKYKYSVPHDLGD
PEEDPFNLVNAYLVHNVSEWRDLNLKFVLQCYRDYTMFGDNKYLADMYPQIKNVMEKSLS
WDTDGDGMIENSGTADQTFDTWIMTGISAYCGGLWLAALYCTVQISNILKQDDISEKYST
ILNKAKESFNAALWNGGYFNFDSSGQHHSKSIMADQLCGEWYLKCCGVNEEVLPVDRVKK
ALHTIYKMNVLGFNDGKMGAVNGMMPDGNPDTFSLQSEEVWTGVTYALSSLMIAHGLRDE
GFNTAKGIYNTVYNNIGMAYQTPEAIYSKNAYRSVGYMRPLSIWSIQTALDNLNKD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattgcgatgatgtcaacaacgataaaggtggcgtgcccgagtacggttggaaa
gtggatttcgatcaccagttccccgatcccagaacgccgtcttacatgccgaggatcaag
cagatattgcagttattaccactgattattaggtatgtattttacatgcttttatgttat
ttaaaaggccagaaaccaataatggattttctatttccaattaagtcaaagcacatgtat
ggtgtacctttgggtggtattggaggtggaaccataggccgtggatttaaaggagagttt
tgtcgttatcaagttgtacctggcatgtacgagtatgaatcggttcaagccaaccagttc
attgtaaatattcaaaatagcgaaaatattactgtttacaataatgttctgtcatgtttg
aagtgtaacaacaaaacattgtacaattggaaatgggattttccatcaaatcaatgtaag
tatactggtctctatccaagatcatggaccgaatatttaattccagaatttcatatcaga
ctcatttgtaagcaaatttcacccattattccacacaactataaagatagttgtatcccg
ggtggtgttttcatatggacagtagaaaacaatagcgatcaacaatattcaataagctta
acatttacgtttgcaagtggtaacggcatttcatcatatcattcagacgaacctagctgt
gaaccattcaacttaaacaaagatggtactgaggttgctggttcactgatacacaattgt
tttaaagaaatgaagtgtacctatgttattggtggattaataaaagaaggtgctgctttc
agtcaattaaattttgatccaaaaggcaatggtatgaccatatcaaaaagcttacattta
tttggagagttgagagatatgcaattaggacctagtaatatatacagtaagtattatact
aagttttttgacaaaaatggaacagctggtcccgaaataatgcattattcaatgcaaaat
tttaaaaaatgggaacaagaaattgaaaaatggcaaaatccaattttaaataatccatta
ttacctgactggtataaaagtgctatattcaatgaagtttattttgtagctgatggcgga
actatttggttcttacctctcaaagaagattatgaacggttagatgtcacagatccaaga
tatcaatatggatattttgggtatttggaaggtcatgagtatcgaatgtacaatacatat
gatgttcatttttatgcatcttttacattagcaaaactgtggcctaaactacaggcatgt
attcaatacaagtttagagatacaattgataatgcattgaatattactagaaaacacttg
tcctgtggtaccagaggtttacggaaatataaatatagtgtaccacatgatctaggtgat
ccagaggaagacccttttaacttggtgaatgcttatttagtacacaatgtatcagaatgg
cgtgatcttaatttaaaatttgttttgcaatgctacagagattacactatgtttggtgat
aacaagtatttggctgatatgtatccacaaataaaaaatgtgatggagaaatcattgtct
tgggatactgatggggatggaatgattgagaattctggaactgctgatcaaacttttgac
acatggataatgactggcatcagtgcttattgtggaggtttatggttagctgctctttat
tgcactgttcagatatcaaatattcttaaacaagatgatatcagtgaaaaatattcgacc
atattaaataaagccaaggaatcatttaatgctgctttgtggaatggtggatatttcaat
tttgattcgtctggtcagcatcattcaaaatcaattatggctgatcaattgtgtggggaa
tggtatttgaaatgttgtggtgtaaacgaagaggtactcccagttgatagagtcaaaaaa
gctcttcatacaatttacaagatgaatgtacttgggttcaatgatggaaaaatgggagct
gtgaatggcatgatgcccgatggaaatccagacacattttcgttgcaaagtgaagaagtt
tggacaggagttacatatgctttgtcctctttaatgattgcacacggtttacgtgatgaa
ggttttaacactgccaagggtatttataatactgtttataataatataggcatggcgtac
cagacaccagaagctatttattctaaaaatgcatatcgctctgttggttatatgagaccc
ctaagtatatggtctattcaaactgcattggataatttaaacaaagactaa

DBGET integrated database retrieval system