KEGG   Acyrthosiphon pisum (pea aphid): 100164524Help
Entry
100164524         CDS       T01076                                 

Definition
(RefSeq) cytosolic 10-formyltetrahydrofolate dehydrogenase
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100164524
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100164524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF2492
Motif
Other DBs
NCBI-GeneID: 100164524
NCBI-ProteinID: XP_001951227
APHIDBASE: ACYPI005534
UniProt: X1WIZ3
Position
Un
AA seq 922 aa AA seqDB search
MLMLRKFFKSRPTSRFGLTYQRDLNVAIIGQSTFAAEVYKLLLKNGHRVVGVFTILDKGN
RQDPLAAVASENNTPVFKIKSWRKGENALPEIVAQYKQVDAELNVLPFCSQFIPMEVIEH
PKHKSICYHPSILPKHRGVSAINWTLMNGDKEAGFSIFWADDGLDTGPILSQKSCPVLPD
DTVDSLYNRFLYPEGIKSMAEAVDMVANGTAPVIPQSTEGSSFEPSVRKKALQKVDWSRS
GVDIQNFIRGLDSSPGAWTIINETEVKLYKSSIWTNETPTGEQVTVDTIQFPAIVHSNGL
LITCNDGLKINIERLSVDGKMMAASNYGNADTVQETIDYTDQEKAYIPVVESIWKNILNM
EIGKDTHFFQSGAGSMDVVRLIEEIKDKLKFTLKNDDVYMSPVFSDFCNTLVKRSRGSTD
DNTRVEYDPVVVDVNNMKLQFAKQLFINGQFVDSESGKTLECINPADESVICSIQCASEA
DVDQAVIAASRAFEGEWSEMSPRDRGAVLYKIADLLDKNREELATIESIDSGAVYTLALK
THIGMSIDVWKYFAGWADKIHGQTIPISHARPNRNLTFTKKEPFGVCGIITPWNYPLMML
SWKMAACLAAGNTVVMKPTEVSPLTALKFAELSVEAGFPAGVINILPGLGSEAGRAIAEH
PDIRKVGFTGSTATGHAIMKASAESNLKKVSLELGGKSPLIILDDCDLDKSVRMSMGGVF
FNKGENCIAAGRVFVESSIHDKFIDKVVEEVKKIKIGNPLERDTHHGPQNHKAHLEKLIN
YCKKAKNEGAELKIGGKRVDRPGYYFEPTVFTGVEDHMFIAQEEAFGPIMAVTKFSSSDL
DAVIKRANSTDYGLSSGIFTKDISKALRFAEKIDAGTVFINTYNKTDVAAPFGGFKKSGF
GKDLGEEALNEYLKTKCITVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgctcagaaaattttttaaatctcgaccgacaagccgtttcggtctgacctat
caacgggacttaaatgttgccatcatcggtcagagtacatttgcagccgaagtgtataag
ttgttgttgaaaaacggtcaccgcgtagttggtgtgtttaccatattagacaaaggcaat
cggcaagatccattggcggctgttgcttcagaaaacaatactccagtatttaaaatcaaa
tcatggcgtaaaggggaaaatgcattacctgaaattgtagctcagtataagcaagttgat
gctgaactcaatgtgctaccattctgttcacagtttattcctatggaggttattgaacat
ccaaaacataaaagtatatgttaccatccttcgattttgcctaaacacagaggagttagc
gccataaattggacactgatgaatggagacaaagaagcaggtttttctatattttgggct
gatgacggactcgatactggtccaatactatctcaaaaatcatgcccagtcttaccagat
gacactgttgattctttgtataatcggtttttatatcctgaaggcatcaaaagtatggct
gaagctgttgatatggtggctaatggtacagctccagttattcctcagtctacagaaggg
tcttcttttgaaccgtctgtaagaaaaaaggctttacaaaaagtagattggtccagaagt
ggagtagatattcagaacttcattagagggctagacagttctcctggtgcttggactatc
ataaatgaaacagaagtaaaattatacaaatcatctatttggacaaatgaaacacctact
ggtgaacaagtgactgttgatacaatccaattcccagctattgtacatagtaatggttta
ttgattacttgcaatgatggtctaaaaataaacattgagaggttgtctgtggatggcaaa
atgatggctgcatcaaattacggtaatgcagacactgttcaagaaactattgactataca
gatcaagaaaaagcatacatccctgtagtggaatccatttggaaaaatatcttaaacatg
gaaattggaaaggatactcatttttttcaatctggtgcaggttctatggacgttgtgagg
ttaattgaagagatcaaggataaattgaaatttactctgaagaatgatgatgtatacatg
tctcctgttttctctgatttctgtaacaccttggtcaagaggtcaagaggttcaaccgat
gacaatactcgtgtagaatatgatccagttgtggttgacgtcaacaatatgaaattacag
tttgcaaaacaattatttatcaatggacagtttgtagactctgagtctggaaagaccttg
gaatgcatcaatcctgctgacgaatctgttatttgttcaattcaatgtgcatctgaagct
gacgtagatcaagcagttattgcggcaagtagggcatttgaaggagaatggtctgaaatg
agtccacgagatcgtggagctgttttatataagatagcagatttgttagataaaaataga
gaagaattagcgacaatagagtctattgattctggtgcagtgtacacattagcattgaaa
actcatattggcatgtctattgatgtttggaaatactttgcgggctgggcagataagata
catgggcaaacaataccaatatcacatgctagacccaatagaaatttaacatttacaaaa
aaagaaccttttggtgtttgtggtattattacaccatggaattatccattgatgatgttg
tcctggaagatggcagcttgtttagcggcgggtaatacagtggtaatgaaaccaacagaa
gtgtcacccctcactgcactgaagtttgctgaattgtctgtggaagctggttttccagct
ggtgttataaacattcttcctgggcttggttctgaggctggtagagcaatagctgaacat
ccagacatcaggaaagtgggattcacaggcagtacagcaacaggtcacgcaatcatgaaa
gcatcggctgaatcaaatctaaaaaaagtatctttggaacttggtggaaaatcccctctg
attatactcgatgactgcgacttggacaaatctgttagaatgagcatgggaggagtgttc
ttcaacaaaggagaaaattgtatagctgcaggtagggtttttgttgagtcaagcatacac
gacaaatttatcgacaaagttgttgaagaagtaaaaaaaataaaaattggaaacccgtta
gaacgtgacactcatcacggacctcaaaatcataaagcccatttagaaaaattaattaac
tattgcaagaaagcaaagaatgaaggagctgaactgaagattggagggaaacgtgtggat
cgaccaggatactattttgagccgactgtattcacaggagttgaagatcatatgtttatt
gctcaagaagaagcatttggacccattatggctgttactaaatttagtagcagtgacctg
gatgcagtcatcaagcgagcaaactcaactgattacggtttatcttccggcatattcaca
aaagacataagcaaagcattgagatttgcagaaaaaattgatgctggaactgtatttata
aacacttataataaaactgatgttgccgcgccttttggtggtttcaaaaaatctggattt
ggcaaggatttaggtgaagaagctttgaacgaatacttaaaaactaaatgcataacagtg
gaatattaa

DBGET integrated database retrieval system