KEGG   Acyrthosiphon pisum (pea aphid): 100164524Help
Entry
100164524         CDS       T01076                                 

Definition
10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:api00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 922 aa AA seqDB search
MLMLRKFFKSRPTSRFGLTYQRDLNVAIIGQSTFAAEVYKLLLKNGHRVVGVFTILDKGN
RQDPLAAVASENNTPVFKIKSWRKGENALPEIVAQYKQVDAELNVLPFCSQFIPMEVIEH
PKHKSICYHPSILPKHRGVSAINWTLMNGDKEAGFSIFWADDGLDTGPILSQKSCPVLPD
DTVDSLYNRFLYPEGIKSMAEAVDMVANGTAPVIPQSTEGSSFEPSVRKKALQKVDWSRS
GVDIQNFIRGLDSSPGAWTIINETEVKLYKSSIWTNETPTGEQVTVDTIQFPAIVHSNGL
LITCNDGLKINIERLSVDGKMMAASNYGNADTVQETIDYTDQEKAYIPVVESIWKNILNM
EIGKDTHFFQSGAGSMDVVRLIEEIKDKLKFTLKNDDVYMSPVFSDFCNTLVKRSRGSTD
DNTRVEYDPVVVDVNNMKLQFAKQLFINGQFVDSESGKTLECINPADESVICSIQCASEA
DVDQAVIAASRAFEGEWSEMSPRDRGAVLYKIADLLDKNREELATIESIDSGAVYTLALK
THIGMSIDVWKYFAGWADKIHGQTIPISHARPNRNLTFTKKEPFGVCGIITPWNYPLMML
SWKMAACLAAGNTVVMKPTEVSPLTALKFAELSVEAGFPAGVINILPGLGSEAGRAIAEH
PDIRKVGFTGSTATGHAIMKASAESNLKKVSLELGGKSPLIILDDCDLDKSVRMSMGGVF
FNKGENCIAAGRVFVESSIHDKFIDKVVEEVKKIKIGNPLERDTHHGPQNHKAHLEKLIN
YCKKAKNEGAELKIGGKRVDRPGYYFEPTVFTGVEDHMFIAQEEAFGPIMAVTKFSSSDL
DAVIKRANSTDYGLSSGIFTKDISKALRFAEKIDAGTVFINTYNKTDVAAPFGGFKKSGF
GKDLGEEALNEYLKTKCITVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgctcagaaaattttttaaatctcgaccgacaagccgtttcggtctgacctat
caacgggacttaaatgttgccatcatcggtcagagtacatttgcagccgaagtgtataag
ttgttgttgaaaaacggtcaccgcgtagttggtgtgtttaccatattagacaaaggcaat
cggcaagatccattggcggctgttgcttcagaaaacaatactccagtatttaaaatcaaa
tcatggcgtaaaggggaaaatgcattacctgaaattgtagctcagtataagcaagttgat
gctgaactcaatgtgctaccattctgttcacagtttattcctatggaggttattgaacat
ccaaaacataaaagtatatgttaccatccttcgattttgcctaaacacagaggagttagc
gccataaattggacactgatgaatggagacaaagaagcaggtttttctatattttgggct
gatgacggactcgatactggtccaatactatctcaaaaatcatgcccagtcttaccagat
gacactgttgattctttgtataatcggtttttatatcctgaaggcatcaaaagtatggct
gaagctgttgatatggtggctaatggtacagctccagttattcctcagtctacagaaggg
tcttcttttgaaccgtctgtaagaaaaaaggctttacaaaaagtagattggtccagaagt
ggagtagatattcagaacttcattagagggctagacagttctcctggtgcttggactatc
ataaatgaaacagaagtaaaattatacaaatcatctatttggacaaatgaaacacctact
ggtgaacaagtgactgttgatacaatccaattcccagctattgtacatagtaatggttta
ttgattacttgcaatgatggtctaaaaataaacattgagaggttgtctgtggatggcaaa
atgatggctgcatcaaattacggtaatgcagacactgttcaagaaactattgactataca
gatcaagaaaaagcatacatccctgtagtggaatccatttggaaaaatatcttaaacatg
gaaattggaaaggatactcatttttttcaatctggtgcaggttctatggacgttgtgagg
ttaattgaagagatcaaggataaattgaaatttactctgaagaatgatgatgtatacatg
tctcctgttttctctgatttctgtaacaccttggtcaagaggtcaagaggttcaaccgat
gacaatactcgtgtagaatatgatccagttgtggttgacgtcaacaatatgaaattacag
tttgcaaaacaattatttatcaatggacagtttgtagactctgagtctggaaagaccttg
gaatgcatcaatcctgctgacgaatctgttatttgttcaattcaatgtgcatctgaagct
gacgtagatcaagcagttattgcggcaagtagggcatttgaaggagaatggtctgaaatg
agtccacgagatcgtggagctgttttatataagatagcagatttgttagataaaaataga
gaagaattagcgacaatagagtctattgattctggtgcagtgtacacattagcattgaaa
actcatattggcatgtctattgatgtttggaaatactttgcgggctgggcagataagata
catgggcaaacaataccaatatcacatgctagacccaatagaaatttaacatttacaaaa
aaagaaccttttggtgtttgtggtattattacaccatggaattatccattgatgatgttg
tcctggaagatggcagcttgtttagcggcgggtaatacagtggtaatgaaaccaacagaa
gtgtcacccctcactgcactgaagtttgctgaattgtctgtggaagctggttttccagct
ggtgttataaacattcttcctgggcttggttctgaggctggtagagcaatagctgaacat
ccagacatcaggaaagtgggattcacaggcagtacagcaacaggtcacgcaatcatgaaa
gcatcggctgaatcaaatctaaaaaaagtatctttggaacttggtggaaaatcccctctg
attatactcgatgactgcgacttggacaaatctgttagaatgagcatgggaggagtgttc
ttcaacaaaggagaaaattgtatagctgcaggtagggtttttgttgagtcaagcatacac
gacaaatttatcgacaaagttgttgaagaagtaaaaaaaataaaaattggaaacccgtta
gaacgtgacactcatcacggacctcaaaatcataaagcccatttagaaaaattaattaac
tattgcaagaaagcaaagaatgaaggagctgaactgaagattggagggaaacgtgtggat
cgaccaggatactattttgagccgactgtattcacaggagttgaagatcatatgtttatt
gctcaagaagaagcatttggacccattatggctgttactaaatttagtagcagtgacctg
gatgcagtcatcaagcgagcaaactcaactgattacggtttatcttccggcatattcaca
aaagacataagcaaagcattgagatttgcagaaaaaattgatgctggaactgtatttata
aacacttataataaaactgatgttgccgcgccttttggtggtttcaaaaaatctggattt
ggcaaggatttaggtgaagaagctttgaacgaatacttaaaaactaaatgcataacagtg
gaatattaa

DBGET integrated database retrieval system