KEGG   Acyrthosiphon pisum (pea aphid): 100164580Help
Entry
100164580         CDS       T01076                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100164580
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100164580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 261 aa AA seqDB search
MRGGAERVCLSSVHGWSEGSVCLHIVFPILQSTRPRCIRNSAISSHRPAEFCLPSANCKG
VTTKMVRQNSKLLVVCGPSGSGKSTLLRKLFDEYPDKFGFSVSHTTRSPRRFEVDGQHYH
FTTKDQMQAAIDRGEFLEHAIFSNNMYGTSLEAVQNVQKSGKICVLDIDMQGVIQIKKVA
NLKPVGVFVKPPSIGELELRLRRRNSESEDNLRARLNVAQQEINYGETPGNFDCIIINES
LDKAYNVFKEFVLKSFEIVEN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcggcgccgaacgcgtctgtctgtcgtctgtgcatgggtggtcggagggaagc
gtatgtttgcatatcgtatttccgattttgcagtccactcgcccacgttgtattcgcaac
tctgcgatttcgtctcaccgaccggctgagttctgtctgccaagtgccaactgcaaaggt
gtcacgacgaaaatggtgcgacagaattcgaagctattggtggtctgcggcccgtcgggc
tccggcaagtcgacgctgctgcgcaagctgttcgacgaatatcctgacaagtttggtttc
tcggtgtcgcacaccacccgatcgccgaggcgtttcgaggtggatggccaacactatcac
ttcactacaaaggaccaaatgcaagcggccatcgatcgaggagaattcctcgagcacgcc
atcttctccaataacatgtatggtaccagccttgaagcggtacaaaatgttcaaaagtct
ggcaagatctgtgttcttgatatcgacatgcaaggggttattcaaatcaaaaaagtggct
aatctgaaaccagtcggtgtgtttgttaaacctcccagtattggtgaactcgaattacga
ttgcgcagacggaattcagagtctgaggataatctacgagctagattgaatgttgcacaa
caggaaattaactatggagaaacgcctggaaactttgattgtattataataaacgagtcc
ttagataaagcatacaatgtgttcaaagaatttgttttaaagtcctttgaaattgttgaa
aattaa

DBGET integrated database retrieval system