KEGG   Acyrthosiphon pisum (pea aphid): 100164587Help
Entry
100164587         CDS       T01076                                 

Definition
4-aminobutyrate aminotransferase, mitochondrial-like
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:api00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:api00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:api00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:api00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:api00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 494 aa AA seqDB search
MYRFQDVARPAATAAKHFVGAPLRMASSICPGEYAAPSVETSVPGPKSKKLLADLSQMQQ
SGSVQLFADYNKSLGNYLVDVDGNVLLDVYTQISSLPLGYNHPDMLKVLDSDENKRAIVN
RPALGVFPAADWPVKLRDTLMSVAPKGMDSLTTMMCGSCSNENAYKNMFMKYQRDKRGGT
SDFTDLEKESCMINMPPGAPKLSILSFKGSFHGRTLGVLSTTHSKYVHKLDVPAFDWPMA
RFPEYKYPLHENLKENEQEDERCLAEVEELIEKWEKKGNPVAGIVVEPIQAEGGDNHASP
YFFQKLQKIAKKYNAGYLIDEVQTGGGPTGKMWCHEHFDLETSPDIVTFSKKMQTGGYYL
KKEFLPDLPYRVFNTWMGDPTKIVLLDAILKVIKRENLLSVVEKSGDVLMSGLRDLEAEF
PALINSTRGRGTFITFDAADAKLRDDIVKRLLAKGVQSGGCGVVGIRMRPALIFQPHHAH
MFNDRLRQVLVETK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtacagattccaagacgtagcccgtccagcggcgacggcggccaaacattttgtcggc
gcaccactgagaatggcatcatcaatttgtcccggagaatatgctgcaccgtcggtcgaa
acgtcagtaccaggaccgaagtcaaaaaaactacttgctgatctttcacaaatgcagcaa
tctggttcggttcagctattcgctgactataacaaatcactgggaaactacttggttgac
gttgacggtaacgttctgttggacgtgtacacgcaaatttcgtcattgccgttgggttac
aaccacccggacatgttgaaagtattggacagcgatgagaacaaaagagccatcgtcaat
cgtccggcgttgggtgtgttcccagctgccgattggccagtgaaactacgagacacactt
atgagtgtcgcacctaaaggtatggactctctaacgaccatgatgtgtgggtcttgttcc
aacgagaacgcgtacaaaaatatgttcatgaagtaccagcgggataaaaggggaggcact
tcggacttcacagacttagagaaggagtcatgcatgattaacatgccgccaggcgcaccc
aagctatctatactgtcgttcaagggttcgttccacggccgcacactgggcgtcctatct
accacgcattctaagtacgtgcacaagttggacgtgcccgcgtttgactggccaatggca
agattccccgagtacaagtatccgctgcatgagaacctcaaggaaaatgaacaagaagac
gaacgttgcttggctgaagtggaggaactgatagagaagtgggaaaagaagggcaacccc
gtggccggaatcgtcgtggagcccatccaggcggaaggcggagacaaccacgcatcgcct
tatttcttccagaaacttcagaagattgccaaaaagtacaacgcgggatatctaatcgac
gaggtgcagacaggcggcggccccaccggtaaaatgtggtgtcacgagcatttcgatctg
gaaacttcgcccgacatcgttacttttagcaagaaaatgcagaccggtggatactacttg
aagaaggaattcttacccgacttgccgtaccgtgtgttcaacacttggatgggagatccg
accaaaatcgtattgctcgatgctatattgaaggtgatcaagagagaaaatctgttgtcg
gtggtcgaaaagtccggcgatgtactcatgtccggactcagagacttggaagccgagttc
ccagcactaatcaactccaccagaggccgcggtacattcataacgttcgatgctgctgac
gcaaaactccgagacgacatcgtcaaaagacttttagccaaaggagtccaatccggagga
tgtggagtagtgggtattagaatgcgaccggcgttgatctttcaaccacatcacgctcac
atgttcaatgacagacttcgccaggtgttggtcgaaactaaatag

DBGET integrated database retrieval system