KEGG   Acyrthosiphon pisum (pea aphid): 100164598Help
Entry
100164598         CDS       T01076                                 

Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100164598
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100164598
Chaperones and folding catalysts [BR:api03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100164598
Membrane trafficking [BR:api04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100164598
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100164598
  Exosomal proteins of colorectal cancer cells
   100164598
  Exosomal proteins of bladder cancer cells
   100164598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_8 AhpC-TSA Redoxin TraF
Motif
Other DBs
NCBI-GeneID: 100164598
NCBI-ProteinID: XP_001950406
APHIDBASE: ACYPI005594
UniProt: J9JYS8
Position
Un
AA seq 490 aa AA seqDB search
MKFMRGLIVFSGFLLSSVLADSVVDLSDSDFDSSVAEFDTSLVMFYAPWCGHCKKLKPEF
EKAAKSLLKEDPPVTLAKVDCTEAGKEVCNKFGVSGYPTLKIFRNGEVSKEYNGPRDSAG
IVKYMKSQVGPSSKDLSSEDIIKNFLSKDDVVVVGFFETETDLKGKFVQLANKLREKVNF
GHTTSQSVIDKYNYKNNVVLYRPKHLSNKFEPDFVVYDGEESTSALDSWITSNYHGLVGY
RQKENMEAFKPPYVGVYYAVDYVKNPKGTNYWRNRVLKVAKSVKDVTFAVNNKDDFQHEI
NEYGLEFVSDDKPIVLARSLDNKKYIMKDEFSVENLEKFVNDFQDGNLEPYIKSESVPED
NTTPVKVAVAKNFDDLVINNGVDTLVEFYAPWCGHCKSLAPVYEQVAEKLKDEAVSLVKM
DATANDVPSTFDVRGFPTLYWLPKDSKNKPIRYEGGRDVNDFIKYIASKATDELSGFDRS
GNPKDGKHEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttatgcgcggattgatcgtgttctccggttttctattgagttccgtacttgcc
gactctgttgtcgatctatcagactctgatttcgactcgtcggtagctgaatttgatacg
tctttggtcatgttctatgccccatggtgcggacactgtaagaaattgaaacccgaattc
gagaaggctgcaaagagtctactgaaagaagatccacctgtaacattggctaaggtggat
tgtacagaagctggtaaggaagtatgtaataaatttggtgtctctggatatccaacttta
aaaatcttccgaaacggtgaagtttctaaagaatacaatggaccccgtgattctgctggt
attgtcaagtacatgaaatcacaagttgggccaagttcaaaagacttatcttcagaagac
attattaagaacttcttatctaaagatgatgtggtggttgttgggttctttgaaacagaa
actgatctcaagggcaaatttgttcaacttgccaacaaattacgtgaaaaagtaaacttt
ggtcataccacttcacagtcagtaattgataaatataactacaagaataatgttgtgctc
tatagacctaagcatttaagtaataaatttgaaccagattttgttgtttatgatggtgaa
gaatcaacttctgctcttgattcttggattacatcaaattatcatggtttggttggttac
cgccaaaaggaaaatatggaggctttcaaacctccttatgttggagtttattacgctgtt
gattacgttaagaacccaaaaggaacaaactactggcgtaatagagtattgaaagttgcc
aagtctgtaaaagatgttactttcgctgtaaacaacaaagatgatttccaacatgaaatt
aatgagtatggattagaatttgtatcagacgacaagcctatagttttggcacgttctctg
gacaacaagaagtacataatgaaggatgaattctcagttgaaaatctagaaaaattcgta
aatgacttccaagacggtaacttagaaccgtacattaaatcagagtcagttcctgaagat
aacactacaccagtaaaagtagctgttgccaaaaactttgatgatttagttattaacaac
ggagttgacacattagtagaattctatgccccatggtgtggccattgtaaaagtttagct
ccggtctatgaacaagttgctgaaaagttaaaagatgaagctgtgtctttggtaaaaatg
gacgcaactgctaatgatgttccttctacttttgatgttcgtggattcccaaccttatat
tggttgcccaaggatagcaaaaataagcctattcgttacgagggaggccgagatgtaaac
gattttatcaagtacatagcatctaaggctacagatgaactcagtggatttgataggtct
ggaaatcctaaagatggcaagcatgaactgtaa

DBGET integrated database retrieval system