KEGG   Acyrthosiphon pisum (pea aphid): 100164598Help
Entry
100164598         CDS       T01076                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100164598
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100164598
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100164598
  Exosomal proteins of colorectal cancer cells
   100164598
  Exosomal proteins of bladder cancer cells
   100164598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 490 aa AA seqDB search
MKFMRGLIVFSGFLLSSVLADSVVDLSDSDFDSSVAEFDTSLVMFYAPWCGHCKKLKPEF
EKAAKSLLKEDPPVTLAKVDCTEAGKEVCNKFGVSGYPTLKIFRNGEVSKEYNGPRDSAG
IVKYMKSQVGPSSKDLSSEDIIKNFLSKDDVVVVGFFETETDLKGKFVQLANKLREKVNF
GHTTSQSVIDKYNYKNNVVLYRPKHLSNKFEPDFVVYDGEESTSALDSWITSNYHGLVGY
RQKENMEAFKPPYVGVYYAVDYVKNPKGTNYWRNRVLKVAKSVKDVTFAVNNKDDFQHEI
NEYGLEFVSDDKPIVLARSLDNKKYIMKDEFSVENLEKFVNDFQDGNLEPYIKSESVPED
NTTPVKVAVAKNFDDLVINNGVDTLVEFYAPWCGHCKSLAPVYEQVAEKLKDEAVSLVKM
DATANDVPSTFDVRGFPTLYWLPKDSKNKPIRYEGGRDVNDFIKYIASKATDELSGFDRS
GNPKDGKHEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttatgcgcggattgatcgtgttctccggttttctattgagttccgtacttgcc
gactctgttgtcgatctatcagactctgatttcgactcgtcggtagctgaatttgatacg
tctttggtcatgttctatgccccatggtgcggacactgtaagaaattgaaacccgaattc
gagaaggctgcaaagagtctactgaaagaagatccacctgtaacattggctaaggtggat
tgtacagaagctggtaaggaagtatgtaataaatttggtgtctctggatatccaacttta
aaaatcttccgaaacggtgaagtttctaaagaatacaatggaccccgtgattctgctggt
attgtcaagtacatgaaatcacaagttgggccaagttcaaaagacttatcttcagaagac
attattaagaacttcttatctaaagatgatgtggtggttgttgggttctttgaaacagaa
actgatctcaagggcaaatttgttcaacttgccaacaaattacgtgaaaaagtaaacttt
ggtcataccacttcacagtcagtaattgataaatataactacaagaataatgttgtgctc
tatagacctaagcatttaagtaataaatttgaaccagattttgttgtttatgatggtgaa
gaatcaacttctgctcttgattcttggattacatcaaattatcatggtttggttggttac
cgccaaaaggaaaatatggaggctttcaaacctccttatgttggagtttattacgctgtt
gattacgttaagaacccaaaaggaacaaactactggcgtaatagagtattgaaagttgcc
aagtctgtaaaagatgttactttcgctgtaaacaacaaagatgatttccaacatgaaatt
aatgagtatggattagaatttgtatcagacgacaagcctatagttttggcacgttctctg
gacaacaagaagtacataatgaaggatgaattctcagttgaaaatctagaaaaattcgta
aatgacttccaagacggtaacttagaaccgtacattaaatcagagtcagttcctgaagat
aacactacaccagtaaaagtagctgttgccaaaaactttgatgatttagttattaacaac
ggagttgacacattagtagaattctatgccccatggtgtggccattgtaaaagtttagct
ccggtctatgaacaagttgctgaaaagttaaaagatgaagctgtgtctttggtaaaaatg
gacgcaactgctaatgatgttccttctacttttgatgttcgtggattcccaaccttatat
tggttgcccaaggatagcaaaaataagcctattcgttacgagggaggccgagatgtaaac
gattttatcaagtacatagcatctaaggctacagatgaactcagtggatttgataggtct
ggaaatcctaaagatggcaagcatgaactgtaa

DBGET integrated database retrieval system