KEGG   Acyrthosiphon pisum (pea aphid): 100164606Help
Entry
100164606         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 565 aa AA seqDB search
MYASSSADKYGTGRTATAKTYHHHHLHHLHHHHVGTSSSSSSSYALSSELSADRRSRAYS
SAPRQVTPVRSTAAASSRLTDINGNIRSLSLSKSLSPASSYSAANGGGSGTLGSGRGEFG
GKTAGSATLLQLGNDNKRYDATKKRLDAFYNSRSPSSLLNKSYNYKAGNLSYFEKYNKQQ
QQDSPPPNEPLQQSRYVNMNRTNYGANTDNGVLHPESSSSAYRSVSDSKKGVVGIRNIGN
TCYMNSVLQCLSNTKSLTDSVLDDVDGADGKLIRVYRDLLSRIWTASDSHPVDTTAFKSA
FQRLSPRFAGYEQQDAQEFLRLLLDRLHMDVNRVKVKPRAMPDVDETLKDNALAAEFWQR
YLVTDNSTVVDLFAGQLKSTLECSSCGHKSITFEVFWDVSLPLPSSGSTNIVSINDLLHN
FTQEEVLDFRERPRCSVCKVDRKMFKSYRFQRLPRYLVLHLKRFQGTQSYKKITSLVAFP
SVSLDMSPYVSGTARSIQPHACKYNLYAVSNHTGTPIAGHYTAMCKHPVTGDWNFFNDSS
VSRITSSAKLISNEAYILFYEAANY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtcatcgtctgccgacaagtacggcaccggcaggaccgcgaccgccaagacg
taccatcaccatcacctccatcacctgcaccatcaccacgtcggtacgtcgtcgtcgtct
tcgtcgtcgtatgcgttgtcgtccgagctgagcgccgatcggcggtccagggcatatagc
agcgcgcccagacaggtgacgccggtccgatcaaccgcggccgcgtcgtcccggttgacg
gacatcaacggtaacatccggtcactgagcctgagcaagagcctgtcgccggcgtcttca
tactctgcggccaacggaggtggatcggggacactaggttctggtcgtggagaatttggt
ggaaagaccgctggttcagccacactgctgcagctaggcaacgacaataaacggtatgac
gcaacgaaaaaacgtttggacgcgttctacaacagcagatcgccgtcgtcgttgctgaac
aaatcatacaattacaaagctggcaacttgtcctacttcgaaaagtacaacaaacagcag
cagcaagactctcctccacccaacgaaccattacagcaatccagatatgtcaacatgaac
agaacaaattacggcgccaacacggacaacggagtgctgcacccggaatcgtcttcgtcg
gcgtacaggtcggtgtccgattcgaaaaagggggtggtcggcattaggaacataggaaac
acgtgctacatgaactctgtgctgcagtgtctgagcaacaccaagagcctgacagacagc
gttctggacgacgtggacggggccgacggtaagttgatccgggtgtaccgagacctcttg
tcccgaatctggaccgcctccgacagccatccggtggacaccaccgcgttcaaatcggct
ttccagcggctgtccccgcggtttgccggctacgagcagcaagacgcccaggagttcctg
cgactgttgctcgaccgactgcatatggacgttaacagggtgaaggtcaagccccgggcc
atgccggacgtggacgaaacgctcaaggacaacgcgctggctgctgagttctggcagagg
tacctggtcacggacaacagtaccgtggtcgacctgttcgccggacagctcaagtctacg
cttgagtgttcctcgtgtggccacaagagtatcacgtttgaggtgttttgggatgtgtcg
ctgccattgccatccagcggctcgactaacatagtgtccatcaacgacctgctgcacaat
ttcacgcaggaagaggtgttggacttccgcgaacggcctcggtgtagcgtttgcaaggtg
gacaggaagatgttcaaatcgtaccggtttcaacgattgcccaggtacctagtgctgcat
ctgaagcgtttccaaggaacgcagtcatacaagaaaattacgtcgctggtggcgttcccg
tccgtgtctctggacatgagcccatacgtatccggcacggcccggagcatacaaccgcac
gcctgcaagtacaacctatatgcggtgtccaaccacacgggcacgccgatcgccggacac
tataccgccatgtgcaagcacccagtcactggcgactggaacttcttcaacgacagctcc
gtctcacggatcacgtcgtccgcgaaactcataagcaacgaggcgtatatactgttttac
gaggccgcgaattattaa

DBGET integrated database retrieval system