KEGG   Acyrthosiphon pisum (pea aphid): 100164739Help
Entry
100164739         CDS       T01076                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100164739
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100164739
   00640 Propanoate metabolism
    100164739
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100164739
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100164739
Enzymes [BR:api01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100164739
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100164739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 2354 aa AA seqDB search
MESTDCNNSEEAVLIDDKMSSETSGGVNFIVGDEDGVDQAPSELVNGDLMKALEEEKHEN
TDSFPLGKETRMGVTSNSSSYNNMFGLTEKRKRLRPSMSQGNVIHQRLTEKDFNVSTPEE
FVKRFKGTRVINKVLIANNGIAAVKCMRSVRRWSYEMFRNERAVRFVVMVTPEDLKANAE
YIKMADHYVPVPGGTNNNNYANVELIVNIAIRSQVQAVWAGWGHASENPELPKLLDKNKI
AFIGPPEKAMFALGDKIASSIVAQTAEIPTLPWSGSGVIGHYSGKKIEIGPDLYKKGCVA
SIEEGLVSAEKVGYPIMIKASEGGGGKGIRKVENTEEFPNAYKQVQAEVPGSPIFIMKLA
KCARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAVIAEPSVFEEMEKAAVRIA
KMVGYVSAGTVEYLYDTDGNYYFLELNPRLQVEHPCTEMVSDVNLPAAQLQISMGLALNC
IKDIRLLYSESAWGDSYIDFDAPRHKPHPWGHVIAARITSENPDEGFKPSSGTVQELNFR
SSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENREQARENLVIALKELSIRGDFRTTVE
YLITLLETESFQSNTIDTAWLDLLISERVQSEKPDIFLGVICGGLHIADRNISESFQNFQ
TSLERGQVLSANTLDHHVSVELINGGYKYKVQVTKSGLNSYFLIMNGSFKEIEVHRLSDG
GILLSLDGSSFTTYMREEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLISFLIEDGGQ
VKKGQPYAEIEVMKMVMTLTATENGRVYYSKRPGAVLDAGSLIATLELDDPSLVTKAVEY
KGQFLELDGTSHIYGESLNNIHTCYRGMLDNILAGYCLPEPYHLVRLREVIEKFMNSLRD
PSLPLLELQEVISSISGRIPKAVDKKIKSLMKLYERNITSVLAQFPSQQIAAIIDGHAAT
LQKRTDRDSFFQTTQGIVQLVQRYRNGIRGRMKSAVHELLKQYYEVESQFQHGSYDKCAT
ALRDRYKDDMAAVTSTIFSHTQVAKKNMLVTMLIDHLWSNEPGLTDELAATLNELTSLNR
SEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQKLIQSETSIF
DILHDFFYHSNRAVCNAALEVYVRRVYISYDLTCLQHLELSGEIPLVHFQFLLPSSHPNR
QQNKINSGANGSENLESPTKTPLPYIPTYQRTGCMAAFESFTQFEQYFDEILDIMEDLSS
PVYVSPRIIDALESGSESRLSSSLNVSLSLGDQRPPDQENVEIEPCHILCIAMKDTGNME
DDKLGKMYEEFCQQRREELKKRSIRRITFLALNKRQFPKLFTYRNYEDFAEDRIYRHLEP
GMAFQLELNRMRTYELEALPTSNRKMYLYLGKAKVPRGQVVTDYRFFIRSIIRHQDLITK
EASFEYLQNEGERVLLEAMDELEVAFSHPHARRTDCNHIFLNFVPTVIMDPAKIKESVTN
MVMRYGPRLWKLRVLQAELRMTIRPSPTSKTSNVRLSLANGSGYHLDICLYKEITDSKLG
MIKFESYESKQGPLHGLPVSTPYVTKDFLQQKRFQAQSAGTTYVYDIPDMFRQMIETLWQ
EYILEHPNDGVLKSSLVFDYVELVVEDNHLIEQKRFSGENTAGMVAWRFTMHTPEYPSGR
DIIVIANDLTVNIGSFGPQEDIVFDLASKEARRKKIPRIYISANSGARIGLAEEIKSLFN
VAWEDPSDPEKGFKYLYLTPDDYGKLAGQNSVEAELIEDEGEPRYKLTDIIGKDFGYGVE
NLKFAGMIAGETSRAYQDIVTISMVTCRAIGIGAYLVRLGQRVIQIENSHIILTGYSALN
KLLGREVYASNNQLGGIQIMYNNGVSHKTEARDLDGVYRILKWLSYIPKTKESPLPVIKS
VDSVERDIDYVPTKVPYDPRWMIAGKEDTNGHWESGFFDKGSWDEIMQPWAQTVVCGRAR
LGGIPVGVIAVETRTVEVTLPADPANLDSESKTVSQAGQVWFPDSAYKTSQAIKDFAHED
LPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDELRQYNQPIITYIPPFGELRGGAWAVVD
TTINPRHIEMYADPDSRGGVLEPEGIVEIKFREKDILKSINRIDTNILSLKANGSPTPEE
AVEIEKNVAERVSVLKPIYHQVAIHFADLHDTPKCMLSKGVIKDIVQWKKSRNTLYWRLK
RRLLQNQIQKVITKSNDTIQDDVAYEMLRRWFVEDKGTTASYLWDNNQAVVQWLTSQLDE
SDGTIVADSLIGNNIKSVRKDAVINQVKSTINDTPEVTSDVIMGMFQSLSEMQRLDLIHN
LTQATSIGNVKLNS
NT seq 7065 nt NT seq  +upstreamnt  +downstreamnt
atggagagcacagattgcaataactctgaagaagctgttttaattgatgataagatgagt
tccgaaactagtggtggtgtgaattttattgtcggtgacgaggatggcgtcgatcaagcg
ccttccgaactcgtcaatggagatttgatgaaagctttagaagaagaaaaacacgaaaat
actgattcttttcctttaggtaaagaaacacgtatgggtgtaacatcaaatagcagctct
tataacaacatgtttggcttaacggaaaagaggaaacgattaaggcctagtatgtctcaa
ggcaatgtgatccatcaacgactcactgaaaaagacttcaatgttagcactcctgaagaa
tttgtaaaacgttttaaaggaacacgagttataaacaaggttttgattgccaacaatggt
attgctgcagtcaaatgcatgagatctgttcgtcgatggtcttatgaaatgtttagaaat
gaaagagctgtacgatttgtagttatggttacaccagaagatcttaaagcaaatgctgag
tatattaaaatggctgatcactatgtaccagtacctggcggtacaaataacaacaattat
gctaatgttgagctcattgtcaatatagctatacgttctcaagttcaggctgtatgggct
ggttggggacatgcttctgagaatccagaactacctaaactgttggacaaaaataaaatt
gcttttattggaccccctgaaaaagctatgtttgctcttggtgataaaattgcttcaagt
attgttgcacaaactgctgaaatcccgacattgccctggtctggttcaggtgtaattgga
cattattctggaaaaaaaattgaaattggaccagatttgtataaaaaaggttgtgttgca
tcaatcgaagaaggtttagtatcagctgaaaaggttgggtatccaattatgattaaagct
agtgaaggtggtggtggtaaaggtataaggaaagtagaaaatactgaagaattcccaaat
gcatacaaacaggttcaagctgaagttcctggatcaccaatatttataatgaaattggct
aagtgcgccaggcatttagaagtacaacttttagctgatcaatatggtaatgctatatca
ttgtttgggcgtgattgttcaattcaaaggagacatcaaaaaattattgaagaggcgccg
gcagtgattgccgaacctagcgtttttgaagaaatggaaaaagccgcagttcgcattgct
aaaatggttggttatgttagtgctggtacagttgagtatctatacgataccgatggaaat
tattactttttggaattaaatcctagactgcaagtggaacatccatgtacagaaatggta
tctgatgtgaatttgccagctgcacaattgcaaatttcaatgggattagccctcaactgt
attaaagacatcagattactttatagcgaatctgcttggggagatagttatatcgatttc
gatgcaccaagacataaacctcatccatggggtcatgttattgctgctcgaatcaccagt
gaaaaccctgatgaaggtttcaagcctagttctgggactgttcaagaattaaatttccgt
tcttcaaaaaatgtatggggatacttcagtgtagctgcctcaggaggattacacgaattt
gctgattctcagtttgggcattgtttctcatggggagaaaatcgagaacaagctagagaa
aatttagttattgcacttaaagaattgtcgattcgaggagatttcagaactacagttgaa
tatttaattacacttcttgaaactgaatcattccagtcaaatacaattgatacagcttgg
ttggatttattgatatcagagcgagtacaatccgaaaagccagacatatttcttggagtc
atttgtggtggacttcatattgctgatcgtaatatatccgaatcattccaaaactttcaa
acatctttagaacgtggtcaggtgttgagtgctaatacacttgatcaccatgtgtctgtt
gaactaataaatggtggatacaaatacaaagttcaagtcactaaatctggactcaattca
tacttcctcattatgaatggttcatttaaggaaattgaagtacatcgtctatctgatggt
ggaattttgttgtctttggatggatcaagttttactacttatatgcgagaagaagtagat
cggtatagaattgtaattggtaatcaaacatgtgtttttgagaaagaaaatgatccatct
ttattacgctcaccgtctgctggtaaactaatcagttttcttatagaggatggtggtcaa
gttaaaaaaggtcaaccatatgctgaaatagaggtaatgaaaatggtaatgacattaaca
gcaacagaaaacggacgtgtgtattatagcaaacggccaggtgccgttcttgatgctggt
tcattaattgcaacacttgaattagatgacccatccttggttacaaaagctgttgaatat
aaaggacagttccttgaacttgatggaacttcacatatttatggagaaagtcttaataat
atacatacatgctacagaggtatgctagataatattctggctgggtattgcttaccagaa
ccatatcatcttgtacgtttgagagaagtcattgaaaagttcatgaactctctacgtgac
ccaagtttacctttattggagttacaggaagtgatatcatcaatatccggcagaatacca
aaagctgtagataaaaaaattaaatcattaatgaagctatacgaaaggaacatcacatct
gtacttgcacaatttcctagccaacaaatagctgcaattattgatggccatgctgcaact
ttacaaaaaagaacagatcgtgacagctttttccaaactactcaaggcattgttcaacta
gtacagagatataggaatggtattcgtggtcgaatgaagtcagctgttcatgagttgctg
aaacaatattatgaagtggaaagtcaattccaacatggaagttatgataaatgtgctact
gcattgagagatagatataaagatgatatggctgctgtaacttcaacgatattctcacac
acacaagtagcaaagaagaatatgttggttacaatgttaattgatcatttatggtccaac
gaacctggtttaacagacgagttggcagctacattaaacgagttgacatcacttaatcgt
agtgaacattctagagttgcacttcgggcccgacaagtactcattgctgcacaccaacca
gcatatgaattaagacataaccaaatggaatcaatatttttatcagcagttgatatgtat
ggacatgattttcatccagaaaacttacaaaaacttatccagtctgaaacttctatattt
gatattcttcatgacttcttttatcattcaaaccgtgcagtctgtaatgccgcattagag
gtttatgtaagacgtgtttacatatcatatgatcttacatgtttgcaacatttggaactg
tctggagaaataccattggtacatttccaatttcttttgccttcttctcatccaaatcgt
caacaaaataagatcaactctggagccaatggttctgaaaatcttgaatcaccgaccaaa
actccattgccatatatcccaacttatcaaagaacaggttgtatggcagcatttgagtca
tttactcaatttgaacaatattttgatgaaatcctggatattatggaagatttatcttct
cctgtatatgtttccccgagaatcattgatgcccttgaaagtggaagtgaatctagatta
agctcatctcttaatgtaagcttgtctcttggtgaccaacgacccccagaccaagaaaac
gttgaaattgaaccgtgtcatatattatgtatagctatgaaagacactggaaatatggaa
gatgataaacttggtaagatgtatgaagaattttgtcaacaacgtagagaagaattgaaa
aaaagatcaatccggagaatcactttcttggctttgaataaaaggcaattccctaaatta
ttcacctacagaaattatgaggattttgctgaagacagaatttatcgtcacttagagcca
ggcatggctttccaattggaattgaacagaatgaggacgtatgaattagaagctttacct
acatcaaacagaaaaatgtatctgtatttaggaaaagctaaagttccaagaggtcaagtt
gtaactgattatcgtttcttcatacgttccattataagacatcaagatttaataacaaaa
gaagcatcttttgaatacctacaaaatgaaggagaacgtgttttgttggaagcgatggat
gaattagaggttgcttttagccacccacatgcacgtagaactgactgtaatcatatattc
ttgaatttcgtacccactgtcataatggatcctgccaaaatcaaagaaagtgttactaat
atggtaatgcggtatggtccacgtctttggaaattacgggttcttcaagctgagcttaga
atgacaatacggccttcacccactagtaaaacttcaaatgttcgattgagccttgcaaat
ggcagtggttatcatttggatatttgcctttacaaagaaattactgactctaagttagga
atgattaaatttgaatcatatgaatcaaagcaaggaccattacacggactacctgtttct
actccatatgtaaccaaagactttcttcaacaaaaaagattccaagctcaaagtgctgga
acaacttacgtttatgatattccagatatgtttagacaaatgatagaaactttatggcaa
gaatacattttggaacacccgaatgatggagttttaaaaagcagcttggtgtttgattat
gttgaacttgtggttgaagacaatcatttaattgaacaaaaacgtttctctggtgaaaat
accgctggtatggttgcttggagatttacaatgcatactccagaatatccttccggccga
gatattattgtgattgctaatgatctaacagtaaacattggttcatttggtccacaagaa
gacattgtcttcgatttagcttctaaagaagcgcgtagaaaaaaaattccacgcatttat
atatcagctaatagtggagctcgtattgggcttgcagaagaaataaaaagtttgttcaat
gttgcatgggaagacccctctgatccggaaaaaggattcaaatatttatacttaacacct
gatgactatggaaaattagctggtcaaaattctgtagaagcagaattaattgaggatgaa
ggtgaaccacgatataaactaactgacattatcggaaaagattttggttatggagttgaa
aatttaaaatttgctgggatgatagctggtgaaacttctcgtgcatatcaagatattgtt
acaatttcaatggtaacttgtcgtgccattggtattggggcttatctagtacgtcttggt
caacgagttattcaaattgagaattctcacattattctcacaggatatagtgctttaaat
aagcttcttggtcgtgaagtatatgcatctaacaatcagttgggtggtattcaaattatg
tacaacaatggtgtgtcacacaagactgaggctagagacttagatggtgtgtacagaata
ctgaagtggctttcttacattccaaaaactaaagaatctccattgcctgtgattaaaagt
gtggattctgtagaaagagatatagactatgtgccgaccaaagtcccatatgatcctcgt
tggatgattgctgggaaagaggatacaaatggccattgggagtcaggattctttgataaa
ggatcatgggatgaaataatgcaaccctgggcacagactgttgtttgtggaagagctagg
ctgggaggaatccctgtcggtgtgattgctgttgaaacaagaaccgtagaagtcacttta
ccggcagatcctgccaatttggattctgaatctaagactgtgtctcaagctggacaagta
tggttcccagactccgcatataaaacatctcaagccattaaagattttgcccatgaagat
ttaccacttttcatctttgctaactggagaggtttttctggtggaatgaaagatatgtat
gaacaaataatgaaatttggtgcgtatattgttgatgaactcagacaatacaaccagcca
attatcacatatatcccgccatttggggagttgcgaggaggtgcatgggctgttgtagat
actactattaatccaagacacattgagatgtatgcagatccagatagccggggtggtgtt
ttggaacctgaaggaattgttgaaattaaattccgtgaaaaagacatcttaaaatctatt
aacagaattgatacgaatattttgagtctcaaagcaaatggtagcccaactcctgaagaa
gcggttgaaatagaaaagaatgttgcagaaagagtatctgtgttgaaacctatttaccat
caagtagcaattcactttgctgacttacatgacacacctaaatgcatgcttagtaaaggt
gttattaaagatattgtacaatggaagaaatctcgtaatacattatattggcgattaaaa
cgacgtttattacaaaaccaaatccaaaaagtaataacaaaatccaatgataccattcaa
gacgatgttgcctatgaaatgctgagaaggtggtttgttgaagacaaaggcaccactgct
tcttatctgtgggataacaaccaagccgtagtacaatggctgacgagtcaattagatgaa
tctgatggcacaattgtagctgattcgttgattggtaataatattaagagtgttagaaaa
gatgcagttataaatcaagtaaaatctacaataaatgacacacctgaagttacatcagac
gttatcatgggcatgttccaaagcctttcggaaatgcaacgtctcgacttgattcataat
ttaacccaggcaacaagcattggcaatgtgaaattaaatagttga

DBGET integrated database retrieval system