KEGG   Acyrthosiphon pisum (pea aphid): 100164739Help
Entry
100164739         CDS       T01076                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100164739
   00640 Propanoate metabolism
    100164739
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100164739
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100164739
Enzymes [BR:api01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100164739
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100164739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
APHIDBASE: 
Position
Un
AA seq 2354 aa AA seqDB search
MESTDCNNSEEAVLIDDKMSSETSGGVNFIVGDEDGVDQAPSELVNGDLMKALEEEKHEN
TDSFPLGKETRMGVTSNSSSYNNMFGLTEKRKRLRPSMSQGNVIHQRLTEKDFNVSTPEE
FVKRFKGTRVINKVLIANNGIAAVKCMRSVRRWSYEMFRNERAVRFVVMVTPEDLKANAE
YIKMADHYVPVPGGTNNNNYANVELIVNIAIRSQVQAVWAGWGHASENPELPKLLDKNKI
AFIGPPEKAMFALGDKIASSIVAQTAEIPTLPWSGSGVIGHYSGKKIEIGPDLYKKGCVA
SIEEGLVSAEKVGYPIMIKASEGGGGKGIRKVENTEEFPNAYKQVQAEVPGSPIFIMKLA
KCARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAVIAEPSVFEEMEKAAVRIA
KMVGYVSAGTVEYLYDTDGNYYFLELNPRLQVEHPCTEMVSDVNLPAAQLQISMGLALNC
IKDIRLLYSESAWGDSYIDFDAPRHKPHPWGHVIAARITSENPDEGFKPSSGTVQELNFR
SSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENREQARENLVIALKELSIRGDFRTTVE
YLITLLETESFQSNTIDTAWLDLLISERVQSEKPDIFLGVICGGLHIADRNISESFQNFQ
TSLERGQVLSANTLDHHVSVELINGGYKYKVQVTKSGLNSYFLIMNGSFKEIEVHRLSDG
GILLSLDGSSFTTYMREEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLISFLIEDGGQ
VKKGQPYAEIEVMKMVMTLTATENGRVYYSKRPGAVLDAGSLIATLELDDPSLVTKAVEY
KGQFLELDGTSHIYGESLNNIHTCYRGMLDNILAGYCLPEPYHLVRLREVIEKFMNSLRD
PSLPLLELQEVISSISGRIPKAVDKKIKSLMKLYERNITSVLAQFPSQQIAAIIDGHAAT
LQKRTDRDSFFQTTQGIVQLVQRYRNGIRGRMKSAVHELLKQYYEVESQFQHGSYDKCAT
ALRDRYKDDMAAVTSTIFSHTQVAKKNMLVTMLIDHLWSNEPGLTDELAATLNELTSLNR
SEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQKLIQSETSIF
DILHDFFYHSNRAVCNAALEVYVRRVYISYDLTCLQHLELSGEIPLVHFQFLLPSSHPNR
QQNKINSGANGSENLESPTKTPLPYIPTYQRTGCMAAFESFTQFEQYFDEILDIMEDLSS
PVYVSPRIIDALESGSESRLSSSLNVSLSLGDQRPPDQENVEIEPCHILCIAMKDTGNME
DDKLGKMYEEFCQQRREELKKRSIRRITFLALNKRQFPKLFTYRNYEDFAEDRIYRHLEP
GMAFQLELNRMRTYELEALPTSNRKMYLYLGKAKVPRGQVVTDYRFFIRSIIRHQDLITK
EASFEYLQNEGERVLLEAMDELEVAFSHPHARRTDCNHIFLNFVPTVIMDPAKIKESVTN
MVMRYGPRLWKLRVLQAELRMTIRPSPTSKTSNVRLSLANGSGYHLDICLYKEITDSKLG
MIKFESYESKQGPLHGLPVSTPYVTKDFLQQKRFQAQSAGTTYVYDIPDMFRQMIETLWQ
EYILEHPNDGVLKSSLVFDYVELVVEDNHLIEQKRFSGENTAGMVAWRFTMHTPEYPSGR
DIIVIANDLTVNIGSFGPQEDIVFDLASKEARRKKIPRIYISANSGARIGLAEEIKSLFN
VAWEDPSDPEKGFKYLYLTPDDYGKLAGQNSVEAELIEDEGEPRYKLTDIIGKDFGYGVE
NLKFAGMIAGETSRAYQDIVTISMVTCRAIGIGAYLVRLGQRVIQIENSHIILTGYSALN
KLLGREVYASNNQLGGIQIMYNNGVSHKTEARDLDGVYRILKWLSYIPKTKESPLPVIKS
VDSVERDIDYVPTKVPYDPRWMIAGKEDTNGHWESGFFDKGSWDEIMQPWAQTVVCGRAR
LGGIPVGVIAVETRTVEVTLPADPANLDSESKTVSQAGQVWFPDSAYKTSQAIKDFAHED
LPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDELRQYNQPIITYIPPFGELRGGAWAVVD
TTINPRHIEMYADPDSRGGVLEPEGIVEIKFREKDILKSINRIDTNILSLKANGSPTPEE
AVEIEKNVAERVSVLKPIYHQVAIHFADLHDTPKCMLSKGVIKDIVQWKKSRNTLYWRLK
RRLLQNQIQKVITKSNDTIQDDVAYEMLRRWFVEDKGTTASYLWDNNQAVVQWLTSQLDE
SDGTIVADSLIGNNIKSVRKDAVINQVKSTINDTPEVTSDVIMGMFQSLSEMQRLDLIHN
LTQATSIGNVKLNS
NT seq 7065 nt NT seq  +upstreamnt  +downstreamnt
atggagagcacagattgcaataactctgaagaagctgttttaattgatgataagatgagt
tccgaaactagtggtggtgtgaattttattgtcggtgacgaggatggcgtcgatcaagcg
ccttccgaactcgtcaatggagatttgatgaaagctttagaagaagaaaaacacgaaaat
actgattcttttcctttaggtaaagaaacacgtatgggtgtaacatcaaatagcagctct
tataacaacatgtttggcttaacggaaaagaggaaacgattaaggcctagtatgtctcaa
ggcaatgtgatccatcaacgactcactgaaaaagacttcaatgttagcactcctgaagaa
tttgtaaaacgttttaaaggaacacgagttataaacaaggttttgattgccaacaatggt
attgctgcagtcaaatgcatgagatctgttcgtcgatggtcttatgaaatgtttagaaat
gaaagagctgtacgatttgtagttatggttacaccagaagatcttaaagcaaatgctgag
tatattaaaatggctgatcactatgtaccagtacctggcggtacaaataacaacaattat
gctaatgttgagctcattgtcaatatagctatacgttctcaagttcaggctgtatgggct
ggttggggacatgcttctgagaatccagaactacctaaactgttggacaaaaataaaatt
gcttttattggaccccctgaaaaagctatgtttgctcttggtgataaaattgcttcaagt
attgttgcacaaactgctgaaatcccgacattgccctggtctggttcaggtgtaattgga
cattattctggaaaaaaaattgaaattggaccagatttgtataaaaaaggttgtgttgca
tcaatcgaagaaggtttagtatcagctgaaaaggttgggtatccaattatgattaaagct
agtgaaggtggtggtggtaaaggtataaggaaagtagaaaatactgaagaattcccaaat
gcatacaaacaggttcaagctgaagttcctggatcaccaatatttataatgaaattggct
aagtgcgccaggcatttagaagtacaacttttagctgatcaatatggtaatgctatatca
ttgtttgggcgtgattgttcaattcaaaggagacatcaaaaaattattgaagaggcgccg
gcagtgattgccgaacctagcgtttttgaagaaatggaaaaagccgcagttcgcattgct
aaaatggttggttatgttagtgctggtacagttgagtatctatacgataccgatggaaat
tattactttttggaattaaatcctagactgcaagtggaacatccatgtacagaaatggta
tctgatgtgaatttgccagctgcacaattgcaaatttcaatgggattagccctcaactgt
attaaagacatcagattactttatagcgaatctgcttggggagatagttatatcgatttc
gatgcaccaagacataaacctcatccatggggtcatgttattgctgctcgaatcaccagt
gaaaaccctgatgaaggtttcaagcctagttctgggactgttcaagaattaaatttccgt
tcttcaaaaaatgtatggggatacttcagtgtagctgcctcaggaggattacacgaattt
gctgattctcagtttgggcattgtttctcatggggagaaaatcgagaacaagctagagaa
aatttagttattgcacttaaagaattgtcgattcgaggagatttcagaactacagttgaa
tatttaattacacttcttgaaactgaatcattccagtcaaatacaattgatacagcttgg
ttggatttattgatatcagagcgagtacaatccgaaaagccagacatatttcttggagtc
atttgtggtggacttcatattgctgatcgtaatatatccgaatcattccaaaactttcaa
acatctttagaacgtggtcaggtgttgagtgctaatacacttgatcaccatgtgtctgtt
gaactaataaatggtggatacaaatacaaagttcaagtcactaaatctggactcaattca
tacttcctcattatgaatggttcatttaaggaaattgaagtacatcgtctatctgatggt
ggaattttgttgtctttggatggatcaagttttactacttatatgcgagaagaagtagat
cggtatagaattgtaattggtaatcaaacatgtgtttttgagaaagaaaatgatccatct
ttattacgctcaccgtctgctggtaaactaatcagttttcttatagaggatggtggtcaa
gttaaaaaaggtcaaccatatgctgaaatagaggtaatgaaaatggtaatgacattaaca
gcaacagaaaacggacgtgtgtattatagcaaacggccaggtgccgttcttgatgctggt
tcattaattgcaacacttgaattagatgacccatccttggttacaaaagctgttgaatat
aaaggacagttccttgaacttgatggaacttcacatatttatggagaaagtcttaataat
atacatacatgctacagaggtatgctagataatattctggctgggtattgcttaccagaa
ccatatcatcttgtacgtttgagagaagtcattgaaaagttcatgaactctctacgtgac
ccaagtttacctttattggagttacaggaagtgatatcatcaatatccggcagaatacca
aaagctgtagataaaaaaattaaatcattaatgaagctatacgaaaggaacatcacatct
gtacttgcacaatttcctagccaacaaatagctgcaattattgatggccatgctgcaact
ttacaaaaaagaacagatcgtgacagctttttccaaactactcaaggcattgttcaacta
gtacagagatataggaatggtattcgtggtcgaatgaagtcagctgttcatgagttgctg
aaacaatattatgaagtggaaagtcaattccaacatggaagttatgataaatgtgctact
gcattgagagatagatataaagatgatatggctgctgtaacttcaacgatattctcacac
acacaagtagcaaagaagaatatgttggttacaatgttaattgatcatttatggtccaac
gaacctggtttaacagacgagttggcagctacattaaacgagttgacatcacttaatcgt
agtgaacattctagagttgcacttcgggcccgacaagtactcattgctgcacaccaacca
gcatatgaattaagacataaccaaatggaatcaatatttttatcagcagttgatatgtat
ggacatgattttcatccagaaaacttacaaaaacttatccagtctgaaacttctatattt
gatattcttcatgacttcttttatcattcaaaccgtgcagtctgtaatgccgcattagag
gtttatgtaagacgtgtttacatatcatatgatcttacatgtttgcaacatttggaactg
tctggagaaataccattggtacatttccaatttcttttgccttcttctcatccaaatcgt
caacaaaataagatcaactctggagccaatggttctgaaaatcttgaatcaccgaccaaa
actccattgccatatatcccaacttatcaaagaacaggttgtatggcagcatttgagtca
tttactcaatttgaacaatattttgatgaaatcctggatattatggaagatttatcttct
cctgtatatgtttccccgagaatcattgatgcccttgaaagtggaagtgaatctagatta
agctcatctcttaatgtaagcttgtctcttggtgaccaacgacccccagaccaagaaaac
gttgaaattgaaccgtgtcatatattatgtatagctatgaaagacactggaaatatggaa
gatgataaacttggtaagatgtatgaagaattttgtcaacaacgtagagaagaattgaaa
aaaagatcaatccggagaatcactttcttggctttgaataaaaggcaattccctaaatta
ttcacctacagaaattatgaggattttgctgaagacagaatttatcgtcacttagagcca
ggcatggctttccaattggaattgaacagaatgaggacgtatgaattagaagctttacct
acatcaaacagaaaaatgtatctgtatttaggaaaagctaaagttccaagaggtcaagtt
gtaactgattatcgtttcttcatacgttccattataagacatcaagatttaataacaaaa
gaagcatcttttgaatacctacaaaatgaaggagaacgtgttttgttggaagcgatggat
gaattagaggttgcttttagccacccacatgcacgtagaactgactgtaatcatatattc
ttgaatttcgtacccactgtcataatggatcctgccaaaatcaaagaaagtgttactaat
atggtaatgcggtatggtccacgtctttggaaattacgggttcttcaagctgagcttaga
atgacaatacggccttcacccactagtaaaacttcaaatgttcgattgagccttgcaaat
ggcagtggttatcatttggatatttgcctttacaaagaaattactgactctaagttagga
atgattaaatttgaatcatatgaatcaaagcaaggaccattacacggactacctgtttct
actccatatgtaaccaaagactttcttcaacaaaaaagattccaagctcaaagtgctgga
acaacttacgtttatgatattccagatatgtttagacaaatgatagaaactttatggcaa
gaatacattttggaacacccgaatgatggagttttaaaaagcagcttggtgtttgattat
gttgaacttgtggttgaagacaatcatttaattgaacaaaaacgtttctctggtgaaaat
accgctggtatggttgcttggagatttacaatgcatactccagaatatccttccggccga
gatattattgtgattgctaatgatctaacagtaaacattggttcatttggtccacaagaa
gacattgtcttcgatttagcttctaaagaagcgcgtagaaaaaaaattccacgcatttat
atatcagctaatagtggagctcgtattgggcttgcagaagaaataaaaagtttgttcaat
gttgcatgggaagacccctctgatccggaaaaaggattcaaatatttatacttaacacct
gatgactatggaaaattagctggtcaaaattctgtagaagcagaattaattgaggatgaa
ggtgaaccacgatataaactaactgacattatcggaaaagattttggttatggagttgaa
aatttaaaatttgctgggatgatagctggtgaaacttctcgtgcatatcaagatattgtt
acaatttcaatggtaacttgtcgtgccattggtattggggcttatctagtacgtcttggt
caacgagttattcaaattgagaattctcacattattctcacaggatatagtgctttaaat
aagcttcttggtcgtgaagtatatgcatctaacaatcagttgggtggtattcaaattatg
tacaacaatggtgtgtcacacaagactgaggctagagacttagatggtgtgtacagaata
ctgaagtggctttcttacattccaaaaactaaagaatctccattgcctgtgattaaaagt
gtggattctgtagaaagagatatagactatgtgccgaccaaagtcccatatgatcctcgt
tggatgattgctgggaaagaggatacaaatggccattgggagtcaggattctttgataaa
ggatcatgggatgaaataatgcaaccctgggcacagactgttgtttgtggaagagctagg
ctgggaggaatccctgtcggtgtgattgctgttgaaacaagaaccgtagaagtcacttta
ccggcagatcctgccaatttggattctgaatctaagactgtgtctcaagctggacaagta
tggttcccagactccgcatataaaacatctcaagccattaaagattttgcccatgaagat
ttaccacttttcatctttgctaactggagaggtttttctggtggaatgaaagatatgtat
gaacaaataatgaaatttggtgcgtatattgttgatgaactcagacaatacaaccagcca
attatcacatatatcccgccatttggggagttgcgaggaggtgcatgggctgttgtagat
actactattaatccaagacacattgagatgtatgcagatccagatagccggggtggtgtt
ttggaacctgaaggaattgttgaaattaaattccgtgaaaaagacatcttaaaatctatt
aacagaattgatacgaatattttgagtctcaaagcaaatggtagcccaactcctgaagaa
gcggttgaaatagaaaagaatgttgcagaaagagtatctgtgttgaaacctatttaccat
caagtagcaattcactttgctgacttacatgacacacctaaatgcatgcttagtaaaggt
gttattaaagatattgtacaatggaagaaatctcgtaatacattatattggcgattaaaa
cgacgtttattacaaaaccaaatccaaaaagtaataacaaaatccaatgataccattcaa
gacgatgttgcctatgaaatgctgagaaggtggtttgttgaagacaaaggcaccactgct
tcttatctgtgggataacaaccaagccgtagtacaatggctgacgagtcaattagatgaa
tctgatggcacaattgtagctgattcgttgattggtaataatattaagagtgttagaaaa
gatgcagttataaatcaagtaaaatctacaataaatgacacacctgaagttacatcagac
gttatcatgggcatgttccaaagcctttcggaaatgcaacgtctcgacttgattcataat
ttaacccaggcaacaagcattggcaatgtgaaattaaatagttga

DBGET integrated database retrieval system