KEGG   Acyrthosiphon pisum (pea aphid): 100164869Help
Entry
100164869         CDS       T01076                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:api01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:api00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:api04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 306 aa AA seqDB search
MHQIGFFSHIFIFILLTILAYGNRINDGSPPVVLWHGMGDSCCNPLSLGRIIKLLQKNLG
TDTYVKSLQIGKSFEQDVKNSFFMNVNLQVKDACKQISIDPKLSSGYNAIGFSQGAQFLR
AVAQRCPNPPMLNLISIGGQHQGVFGMPRCLYSSHKWCEYIRLVLNKEAYAKWVQNSLVQ
AEYWHDPIKESDYIKGSHFLADINNERIINENYRENLLKLKNFIMVMFTNDTMVIPKESE
WFAFYSPGQDKEIMPLEQSVFYLTDRLGLKVLEESGRLHFLSVPGNHLQFSEEWFLNEIV
NKYLKE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaattggatttttttcacacatatttattttcattcttttaacaattttggct
tatggtaatcgaatcaatgatggttcgcccccagttgtattatggcatggaatgggcgat
agctgttgtaatccattaagtcttggaagaattattaagttattacagaagaacttggga
accgatacttatgtgaagtcgttacaaattggaaaatcttttgaacaggatgtgaagaac
agttttttcatgaatgttaaccttcaagttaaagatgcttgcaaacaaatatctatagat
ccaaagttgtctagtggttataatgctattggattttcacaaggagctcaatttttgaga
gcagttgcacaaagatgtcctaatcctccaatgttaaatcttatatctataggcggccaa
catcaaggagtttttggtatgccaagatgtctttattctagtcacaaatggtgcgaatat
ataagattagttttgaacaaagaagcttatgcaaaatgggtacaaaattcattagttcaa
gcagaatattggcatgatccaattaaggaatcagattatataaaaggtagccatttttta
gcagacatcaacaatgaacgcattattaatgaaaattatcgtgaaaatttgctcaaatta
aaaaactttatcatggttatgtttacaaatgatacaatggttattccaaaagaaagtgaa
tggtttgcattttactcaccaggtcaagataaagaaattatgccacttgaacagtctgta
ttttacctcacagaccgacttggtttgaaagtattagaagaaagtggacgtttacatttc
ttgtcagttcctggtaatcatcttcagttttctgaagaatggtttttgaatgaaattgtt
aataaatatctcaaagaatag

DBGET integrated database retrieval system