KEGG   Acyrthosiphon pisum (pea aphid): 100164923Help
Entry
100164923         CDS       T01076                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100164923
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100164923
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100164923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 399 aa AA seqDB search
MWAISGLAFVVWLLTATSASARYPVILVPGDGGSRIDAKLNKPSVVHYLCDKKTNDYSNI
WLNLELLVPYAIDCLIDNMRLIYDNVTHTTHSPPGVDIRVPGWGNSSAVEYIDPSLTTFG
AYFKSVGDTLVGTGLERDVSIRGAPYDFRKAPNENTEFFVKLKTLTEETYQQNNNTPVVF
IVHSMGGCMTLKFLRAQTQKWKDQYVRAMVSLAGAWGGAVKALKVFTVGDDLGVYVLSGS
VLKAEQITSPSLAWLLPSPYFWKSDEVLVETDTKNFTVTNYKSFFEGIDYMTGYDMYLDV
KQYMDFGPPGVEVHCLHGSAIQTVEKMIFGPGKFPLKYPKLQYGYGDGTVNSRSLEGCNY
WSSMQKQKVFHQVFPKADHMTILKDERVMDYIAQLMEKL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccattagcggcttagccttcgttgtgtggctgttgaccgcgacatccgcttcc
gccagatatccggtcatcttggttcctggtgatggcggtagccgcattgatgctaaatta
aacaaacccagtgtcgttcattatttatgtgataaaaaaacaaatgattattctaacatt
tggttgaatctcgaattgttagtgccatatgcaatagactgtttgatagataatatgaga
ctgatatatgacaatgttacccatactactcacagtcctccaggtgtagatataagagta
cctggatggggaaattcttctgctgttgaatacattgatcctagtttaaccacatttggc
gcttactttaagagtgttggtgatacattagtaggcactggtcttgagcgagatgtttct
attcggggagcgccatatgattttagaaaagctcctaatgaaaatacagagttttttgtg
aaactaaagacactaactgaagaaacataccaacaaaataataatacaccagttgtgttc
attgtacacagcatgggaggatgtatgacattgaaatttttgcgagctcaaacgcagaag
tggaaagatcaatatgtcagagcaatggtttcattagctggtgcttggggtggagctgtt
aaagcattgaaagtttttaccgtaggtgatgacctaggagtttatgtacttagtggcagt
gttctaaaagctgaacaaattacatctcccagcttagcatggcttttaccatccccatat
ttttggaagtcagatgaggtattagtggaaactgatacaaaaaactttacagtgacaaac
tataaatcattttttgaaggcatagactacatgactggctatgatatgtacttagacgtt
aagcagtacatggattttggaccacctggtgtagaagtccattgcttacacggtagtgca
attcaaacagttgaaaaaatgatttttggaccaggaaaatttccgcttaagtatcctaag
ttacaatatggttatggcgatggcacagttaattccagaagcctagaaggttgcaattat
tggtcaagtatgcaaaagcaaaaagttttccatcaagtatttccaaaagctgaccacatg
acaatcttgaaggatgaacgagtaatggattacattgcacagctcatggaaaaactatag

DBGET integrated database retrieval system